BP920080
Clone id YMU001_000132_G07
Library
Length 520
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000132_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCATTTGGAACGCATGTTGTTCTGTGTGGGATTGCTAGTGGGCTTCTGGGCAAATTTAG
CCCAGATGTGCTCAGTATTCAGTTTACCAAAGGGCTACTTGGCTGGTTGGTGAATGCTAC
ACTCATCAAGCTCTCTCTTTATGCCCTTGGTAACGGTGATGCAGCGATATTCGACATACT
CTCATATGGGGGCTATGCCTTTGTTGGTGTATCGCTCTCAGTGATGGCACGCATGTTGTG
GCATTACTCGTATTACGTCCTCATGCCGTTAACTAGTCTTTGTATGGCTGTTTTCTTGGT
AAAGACAATGAAGCGCGTCGTCTTTGCTGAAGTGAGAAGTTATGAGAGGGACTCTAGCAG
GCACCATTATTTACTTTTATTTATTGCAGTTGCACAGTTTCCATTGTCATTATGGCTTGG
ATATCTTAAAGGTACATGATACAAGCCGCTCTCCGAATGTATACACAAATGTATCATATT
GAACATGGGCCTTGTCGTGTCCAGCAAAATGCTTAACAGT
■■Homology search results ■■ -
sp_hit_id Q6PC24
Definition sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio
Align length 135
Score (bit) 70.1
E-value 6.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920080|Adiantum capillus-veneris mRNA, clone:
YMU001_000132_G07.
(520 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio GN=yif1a PE=2... 70 6e-12
sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B OS=Xenopus laevis GN=yif1b... 70 6e-12
sp|Q5U3G6|YIF1B_DANRE Protein YIF1B OS=Danio rerio GN=yif1b PE=2... 70 8e-12
sp|Q6P301|YIF1B_XENTR Protein YIF1B OS=Xenopus tropicalis GN=yif... 69 2e-11
sp|Q6GN58|YF1BA_XENLA Protein YIF1B-A OS=Xenopus laevis GN=yif1b... 67 4e-11
sp|Q9CX30|YIF1B_MOUSE Protein YIF1B OS=Mus musculus GN=Yif1b PE=... 67 7e-11
sp|Q5BJH7|YIF1B_HUMAN Protein YIF1B OS=Homo sapiens GN=YIF1B PE=... 66 9e-11
sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens GN=YIF1A PE=... 65 2e-10
sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2 ... 64 3e-10
sp|Q91XB7|YIF1A_MOUSE Protein YIF1A OS=Mus musculus GN=Yif1a PE=... 63 7e-10
sp|P87148|YIF1_SCHPO Protein transport protein yif1 OS=Schizosac... 60 6e-09
sp|Q3UMR5|C109A_MOUSE Coiled-coil domain-containing protein 109A... 35 0.21
sp|Q8NE86|C109A_HUMAN Coiled-coil domain-containing protein 109A... 35 0.21
sp|Q58287|Y877_METJA Putative ABC transporter permease protein M... 32 1.8
sp|Q499N4|COQ2_RAT Para-hydroxybenzoate--polyprenyltransferase, ... 32 1.8
sp|Q08BI9|C109A_DANRE Coiled-coil domain-containing protein 109A... 32 1.8
sp|P36672|PTTBC_ECOLI PTS system trehalose-specific EIIBC compon... 31 4.0
sp|P84615|DCAL1_DRONO Dromaiocalcin-1 OS=Dromaius novae-hollandi... 31 4.0
sp|Q9K1B0|NUOL_NEIMB NADH-quinone oxidoreductase subunit L OS=Ne... 30 5.3
sp|Q9JX92|NUOL_NEIMA NADH-quinone oxidoreductase subunit L OS=Ne... 30 5.3
sp|P15686|HUP1_CHLKE H(+)/hexose cotransporter 1 OS=Chlorella ke... 30 5.3
sp|Q4KMM3|OXR1_MOUSE Oxidation resistance protein 1 OS=Mus muscu... 30 6.9
sp|Q7QJT4|PRIC1_ANOGA Protein prickle OS=Anopheles gambiae GN=pk... 30 8.8
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thali... 30 8.8
sp|Q54DK1|SQRD_DICDI Sulfide:quinone oxidoreductase, mitochondri... 30 9.0

>sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio GN=yif1a PE=2
SV=1
Length = 307

Score = 70.1 bits (170), Expect = 6e-12
Identities = 42/135 (31%), Positives = 78/135 (57%), Gaps = 4/135 (2%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T+++L G+A G+ +FSP+VL + + L+ ++ ++ LSLY L + D + FD+
Sbjct: 155 AFITYILLAGMALGIQKRFSPEVLGLCASTALVWMIIEVLVMLLSLYLLTVHTDLSTFDL 214

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVR--SYER 349
++Y GY +VG+ L+V +L+ YYV + +S + F+V+++K + + + S
Sbjct: 215 VAYSGYKYVGMILTVFCGLLFGSDGYYVALAWSSCALMFFIVRSLKMKILSSISADSMGA 274

Query: 350 DSSRHHYLLLFIAVA 394
+S L+I VA
Sbjct: 275 GASAKPRFRLYITVA 289


>sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B OS=Xenopus laevis GN=yif1b-B
PE=2 SV=1
Length = 300

Score = 70.1 bits (170), Expect = 6e-12
Identities = 44/149 (29%), Positives = 80/149 (53%), Gaps = 8/149 (5%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T++++ G+A G +FSP++L +Q + L +V I LSLY + N D D+
Sbjct: 149 AFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDL 208

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSY---- 343
+++ GY +VG+ V+A +L+ + YYV++ + + F+++T++ + +E +
Sbjct: 209 VAFSGYKYVGMISGVIAGLLFGNTGYYVVLAWCCISIVFFMIRTLRLKILSEAAAEGVLV 268

Query: 344 --ERDSSRHHYLLLFIAVAQFPLSLWLGY 424
R+ R YL + IA Q WL Y
Sbjct: 269 RGARNQLR-MYLTMAIAAVQPIFMYWLTY 296


>sp|Q5U3G6|YIF1B_DANRE Protein YIF1B OS=Danio rerio GN=yif1b PE=2
SV=2
Length = 304

Score = 69.7 bits (169), Expect = 8e-12
Identities = 42/147 (28%), Positives = 78/147 (53%), Gaps = 7/147 (4%)
Frame = +2

Query: 5 FGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDIL 181
F T+V++ G+A G +FSP++L IQ + L+ ++ + LSLY + N D D++
Sbjct: 154 FITYVLVAGLALGTQNRFSPEILGIQASSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLV 213

Query: 182 SYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYER--- 349
++ GY +VG+ + V+A +L+ YY+ + + VF ++T++ + +E + R
Sbjct: 214 AFSGYKYVGMIVGVVAGLLFGRTGYYLALLWFCASIFVFTIRTLRLKILSEAAAEGRLVR 273

Query: 350 --DSSRHHYLLLFIAVAQFPLSLWLGY 424
+ YL + IA AQ WL +
Sbjct: 274 GTKNQLRMYLTMAIAAAQPVFMYWLTF 300


>sp|Q6P301|YIF1B_XENTR Protein YIF1B OS=Xenopus tropicalis GN=yif1b
PE=2 SV=1
Length = 300

Score = 68.6 bits (166), Expect = 2e-11
Identities = 43/149 (28%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T++++ G+A G +FSP++L +Q + L +V I LSLY + N D D+
Sbjct: 149 AFITYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDL 208

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSY---- 343
+++ GY +VG+ V++ +L+ YYV++ + + F+++T++ + +E +
Sbjct: 209 VAFSGYKYVGMISGVISGLLFGKTGYYVVLSWCGISVVFFMIRTLRLKILSEAAAEGVLV 268

Query: 344 --ERDSSRHHYLLLFIAVAQFPLSLWLGY 424
R+ R YL + IA Q WL Y
Sbjct: 269 RGARNQLR-MYLTMAIAAVQPIFMYWLTY 296


>sp|Q6GN58|YF1BA_XENLA Protein YIF1B-A OS=Xenopus laevis GN=yif1b-A
PE=2 SV=1
Length = 300

Score = 67.4 bits (163), Expect = 4e-11
Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T++++ G+A G +FSP++L +Q + L +V I LSLY + N D D+
Sbjct: 149 AFVTYILVAGLALGTQSRFSPEILGMQASSALAWLIVEVLAILLSLYLVTVNTDLTTVDL 208

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSY---- 343
+++ GY +VG+ V++ +L+ YY+++ + + F+++T++ + +E +
Sbjct: 209 VAFTGYKYVGMISGVISGLLFGKTGYYIVLAWCCISIVFFMIRTLRLKILSEAAAEGVLV 268

Query: 344 --ERDSSRHHYLLLFIAVAQFPLSLWLGY 424
R+ R YL + IA Q WL Y
Sbjct: 269 RGARNQLR-MYLTMAIAAVQPIFMYWLTY 296


>sp|Q9CX30|YIF1B_MOUSE Protein YIF1B OS=Mus musculus GN=Yif1b PE=2
SV=2
Length = 311

Score = 66.6 bits (161), Expect = 7e-11
Identities = 43/149 (28%), Positives = 80/149 (53%), Gaps = 8/149 (5%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T++++ G+A G +FSPD+L +Q + L + I LSLY + N D D+
Sbjct: 160 AFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDL 219

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSY---- 343
+++ GY +VG+ V+ +L+ YY+++ + + VF+++T++ + A+ +
Sbjct: 220 VAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPV 279

Query: 344 --ERDSSRHHYLLLFIAVAQFPLSLWLGY 424
R+ R YL + +A AQ L WL +
Sbjct: 280 RGARNQLR-MYLTMAVAAAQPVLMYWLTF 307


>sp|Q5BJH7|YIF1B_HUMAN Protein YIF1B OS=Homo sapiens GN=YIF1B PE=1
SV=1
Length = 314

Score = 66.2 bits (160), Expect = 9e-11
Identities = 44/149 (29%), Positives = 80/149 (53%), Gaps = 8/149 (5%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALG-NGDAAIFDI 178
AF T+V++ G+A G +FSPD+L +Q + L + I LSLY + N D D+
Sbjct: 163 AFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDL 222

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSY---- 343
+++ GY +VG+ V+ +L+ YY+++ + + VF+++T++ + A+ +
Sbjct: 223 VAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGVPV 282

Query: 344 --ERDSSRHHYLLLFIAVAQFPLSLWLGY 424
R+ R YL + +A AQ L WL +
Sbjct: 283 RGARNQLR-MYLTMAVAAAQPMLMYWLTF 310


>sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens GN=YIF1A PE=1
SV=2
Length = 293

Score = 65.1 bits (157), Expect = 2e-10
Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (1%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLY-ALGNGDAAIFDI 178
AF T+V+L G+A G+ +FSP+VL + + L+ ++ + L LY A D + F +
Sbjct: 145 AFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHL 204

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMK 313
L+Y GY +VG+ LSV+ +L+ YYV + TS + F+V++++
Sbjct: 205 LAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLR 250


>sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2
SV=1
Length = 293

Score = 64.3 bits (155), Expect = 3e-10
Identities = 36/106 (33%), Positives = 64/106 (60%), Gaps = 2/106 (1%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLY-ALGNGDAAIFDI 178
AF T+V+L G+A G+ +FSP+VL + + L+ ++ + L +Y A D + F +
Sbjct: 145 AFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGIYLATVRSDLSTFHL 204

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMK 313
L+Y GY +VG+ LSV+ +L+ YYV + TS + F+V++++
Sbjct: 205 LAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLR 250


>sp|Q91XB7|YIF1A_MOUSE Protein YIF1A OS=Mus musculus GN=Yif1a PE=2
SV=1
Length = 293

Score = 63.2 bits (152), Expect = 7e-10
Identities = 36/106 (33%), Positives = 63/106 (59%), Gaps = 2/106 (1%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLY-ALGNGDAAIFDI 178
AF T+V+L G+A G+ +FSP+VL + + L+ + + L LY A + + F +
Sbjct: 145 AFITYVLLAGMALGIQQRFSPEVLGLCASTALVWVFMEVLALLLGLYLATVRSELSTFHL 204

Query: 179 LSYGGYAFVGVSLSVMARMLW-HYSYYVLMPLTSLCMAVFLVKTMK 313
L+Y GY +VG+ LSV+ +L+ YYV + TS + F+V++++
Sbjct: 205 LAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLR 250


tr_hit_id A9NUX7
Definition tr|A9NUX7|A9NUX7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 142
Score (bit) 222.0
E-value 1.0e-56
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920080|Adiantum capillus-veneris mRNA, clone:
YMU001_000132_G07.
(520 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NUX7|A9NUX7_PICSI Putative uncharacterized protein OS=Picea... 222 1e-56
tr|Q9FYH6|Q9FYH6_ARATH F17F8.24 OS=Arabidopsis thaliana PE=4 SV=1 182 1e-44
tr|Q94BQ9|Q94BQ9_ARATH Putative uncharacterized protein At1g3089... 182 1e-44
tr|A7QM95|A7QM95_VITVI Chromosome chr5 scaffold_124, whole genom... 182 1e-44
tr|Q9M1B7|Q9M1B7_ARATH Putative uncharacterized protein T16L24.5... 181 3e-44
tr|Q7XA88|Q7XA88_ARATH At3g59500 OS=Arabidopsis thaliana PE=2 SV=1 179 1e-43
tr|Q0WT16|Q0WT16_ARATH Putative uncharacterized protein At3g5950... 179 1e-43
tr|A2XQ96|A2XQ96_ORYSI Putative uncharacterized protein OS=Oryza... 178 2e-43
tr|B4FPP0|B4FPP0_MAIZE Putative uncharacterized protein OS=Zea m... 177 2e-43
tr|B6STI1|B6STI1_MAIZE Protein YIF1A OS=Zea mays PE=2 SV=1 177 3e-43
tr|Q7XS61|Q7XS61_ORYSJ Os04g0165400 protein OS=Oryza sativa subs... 177 4e-43
tr|A3AQX5|A3AQX5_ORYSJ Putative uncharacterized protein OS=Oryza... 177 4e-43
tr|Q69XN2|Q69XN2_ORYSJ Putative yip1 interacting factor OS=Oryza... 176 5e-43
tr|Q0DAW9|Q0DAW9_ORYSJ Os06g0620600 protein OS=Oryza sativa subs... 176 5e-43
tr|B8B4N4|B8B4N4_ORYSI Putative uncharacterized protein OS=Oryza... 176 5e-43
tr|A3BDM4|A3BDM4_ORYSJ Putative uncharacterized protein OS=Oryza... 176 5e-43
tr|B6UAQ1|B6UAQ1_MAIZE Protein YIF1A OS=Zea mays PE=2 SV=1 175 1e-42
tr|B4FKT1|B4FKT1_MAIZE Putative uncharacterized protein OS=Zea m... 172 1e-41
tr|B6T3P3|B6T3P3_MAIZE Protein YIF1A OS=Zea mays PE=2 SV=1 169 8e-41
tr|A9SY22|A9SY22_PHYPA Predicted protein OS=Physcomitrella paten... 167 3e-40
tr|A9TDS8|A9TDS8_PHYPA Predicted protein OS=Physcomitrella paten... 159 6e-38
tr|A7PFQ8|A7PFQ8_VITVI Chromosome chr11 scaffold_14, whole genom... 147 3e-34
tr|B4FJ39|B4FJ39_MAIZE Putative uncharacterized protein OS=Zea m... 137 4e-31
tr|A7Q235|A7Q235_VITVI Chromosome chr13 scaffold_45, whole genom... 91 3e-17
tr|A8IPU0|A8IPU0_CHLRE Predicted protein OS=Chlamydomonas reinha... 83 7e-15
tr|Q4SEL0|Q4SEL0_TETNG Chromosome 10 SCAF14616, whole genome sho... 74 3e-12
tr|A7RZV4|A7RZV4_NEMVE Predicted protein (Fragment) OS=Nematoste... 70 5e-11
tr|B8JMB4|B8JMB4_DANRE Novel protein similar to vertebrate Yip1 ... 70 6e-11
tr|A2CEM6|A2CEM6_DANRE Novel protein (Zgc:73136) OS=Danio rerio ... 70 6e-11
tr|B5X166|B5X166_SALSA YIF1A OS=Salmo salar GN=YIF1A PE=2 SV=1 69 1e-10

>tr|A9NUX7|A9NUX7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 283

Score = 222 bits (565), Expect = 1e-56
Identities = 101/142 (71%), Positives = 125/142 (88%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT++VLCG+ GLLGKFSP+ +SIQF+KGLLGWL L++LSLYALG G+A I D++
Sbjct: 140 AFGTYIVLCGLTIGLLGKFSPEAMSIQFSKGLLGWLAQLFLLRLSLYALGGGEAPILDLV 199

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGYAFVG++LSV+AR+LW YSYYV++ T LCM +FLVKTMKR++FAE RSY+RDSSR
Sbjct: 200 AYGGYAFVGIALSVLARILWSYSYYVVILWTCLCMGIFLVKTMKRILFAEARSYDRDSSR 259

Query: 362 HHYLLLFIAVAQFPLSLWLGYL 427
HHYLLLF+AVAQFPL LWLGY+
Sbjct: 260 HHYLLLFMAVAQFPLFLWLGYI 281


>tr|Q9FYH6|Q9FYH6_ARATH F17F8.24 OS=Arabidopsis thaliana PE=4 SV=1
Length = 286

Score = 182 bits (461), Expect = 1e-44
Identities = 84/140 (60%), Positives = 112/140 (80%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+VVL G++ GL GKF+P+ L+ F KGL+GW + L+K++L +LG+G+A + DI+
Sbjct: 141 AFGTYVVLAGLSLGLNGKFTPEALNWLFVKGLVGWFLQVMLLKVTLLSLGSGEAPLLDIV 200

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGYAF G+ L+ A+++W YSYY LMP T LC +FLVKTMKRV+FAEVRSY DSS+
Sbjct: 201 AYGGYAFAGLCLAGFAKIMWGYSYYALMPWTCLCTGIFLVKTMKRVLFAEVRSY--DSSK 258

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLLLF+A+ QFPL +WLG
Sbjct: 259 HHYLLLFLALVQFPLLIWLG 278


>tr|Q94BQ9|Q94BQ9_ARATH Putative uncharacterized protein At1g30890
(Putative uncharacterized protein) OS=Arabidopsis
thaliana GN=At1g30890 PE=2 SV=1
Length = 269

Score = 182 bits (461), Expect = 1e-44
Identities = 84/140 (60%), Positives = 112/140 (80%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+VVL G++ GL GKF+P+ L+ F KGL+GW + L+K++L +LG+G+A + DI+
Sbjct: 124 AFGTYVVLAGLSLGLNGKFTPEALNWLFVKGLVGWFLQVMLLKVTLLSLGSGEAPLLDIV 183

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGYAF G+ L+ A+++W YSYY LMP T LC +FLVKTMKRV+FAEVRSY DSS+
Sbjct: 184 AYGGYAFAGLCLAGFAKIMWGYSYYALMPWTCLCTGIFLVKTMKRVLFAEVRSY--DSSK 241

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLLLF+A+ QFPL +WLG
Sbjct: 242 HHYLLLFLALVQFPLLIWLG 261


>tr|A7QM95|A7QM95_VITVI Chromosome chr5 scaffold_124, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001972001
PE=4 SV=1
Length = 259

Score = 182 bits (461), Expect = 1e-44
Identities = 85/140 (60%), Positives = 110/140 (78%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+V+L G++ GL GKF+P+ L+ F KGL+GW + +L+K+SL +LG+G+A + DI+
Sbjct: 114 AFGTYVILAGLSLGLRGKFTPEALNWLFIKGLVGWCLQVSLLKVSLLSLGSGEAPLLDIV 173

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+Y GY F G+ L+V R+ W YSYY LMP LCM +FLVKTMKRV+FAEVRSY DSSR
Sbjct: 174 AYAGYTFTGMCLAVFGRIAWSYSYYFLMPWACLCMGIFLVKTMKRVLFAEVRSY--DSSR 231

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLLLFIA+AQ PL +WLG
Sbjct: 232 HHYLLLFIALAQLPLFIWLG 251


>tr|Q9M1B7|Q9M1B7_ARATH Putative uncharacterized protein T16L24.50
OS=Arabidopsis thaliana GN=T16L24.50 PE=4 SV=1
Length = 259

Score = 181 bits (458), Expect = 3e-44
Identities = 82/140 (58%), Positives = 112/140 (80%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+VVL G++ GL GKF+P+ L+ F KG++GW + L+K++L +LG+G+A + DI+
Sbjct: 114 AFGTYVVLAGLSLGLYGKFTPEALNWLFVKGMVGWFLQVMLLKITLLSLGSGEAPLLDIV 173

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+Y GY F G+ L+V+ +++W YSYYVL+P T LC VFLVKTMKRV+FAE RSY DSSR
Sbjct: 174 AYAGYTFTGLCLAVLGKIIWGYSYYVLIPWTCLCTGVFLVKTMKRVLFAESRSY--DSSR 231

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLL+F+A+AQFPL +WLG
Sbjct: 232 HHYLLIFVALAQFPLLIWLG 251


>tr|Q7XA88|Q7XA88_ARATH At3g59500 OS=Arabidopsis thaliana PE=2 SV=1
Length = 259

Score = 179 bits (453), Expect = 1e-43
Identities = 81/140 (57%), Positives = 111/140 (79%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+VVL G++ GL GKF+P+ L+ F KG++GW + L+K++L +LG+G+A + DI+
Sbjct: 114 AFGTYVVLAGLSLGLYGKFTPEALNWLFVKGMVGWFLQVMLLKITLLSLGSGEAPLLDIV 173

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+Y GY F G+ L+V+ +++W YSYYVL+P T LC VFLVK MKRV+FAE RSY DSSR
Sbjct: 174 AYAGYTFTGLCLAVLGKIIWGYSYYVLIPWTCLCTGVFLVKAMKRVLFAESRSY--DSSR 231

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLL+F+A+AQFPL +WLG
Sbjct: 232 HHYLLIFVALAQFPLLIWLG 251


>tr|Q0WT16|Q0WT16_ARATH Putative uncharacterized protein At3g59500
OS=Arabidopsis thaliana GN=At3g59500 PE=2 SV=1
Length = 269

Score = 179 bits (453), Expect = 1e-43
Identities = 81/140 (57%), Positives = 111/140 (79%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFGT+VVL G++ GL GKF+P+ L+ F KG++GW + L+K++L +LG+G+A + DI+
Sbjct: 124 AFGTYVVLAGLSLGLYGKFTPEALNWLFVKGMVGWFLQVMLLKITLLSLGSGEAPLLDIV 183

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+Y GY F G+ L+V+ +++W YSYYVL+P T LC VFLVK MKRV+FAE RSY DSSR
Sbjct: 184 AYAGYTFTGLCLAVLGKIIWGYSYYVLIPWTCLCTGVFLVKAMKRVLFAESRSY--DSSR 241

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HHYLL+F+A+AQFPL +WLG
Sbjct: 242 HHYLLIFVALAQFPLLIWLG 261


>tr|A2XQ96|A2XQ96_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14805 PE=4 SV=1
Length = 301

Score = 178 bits (451), Expect = 2e-43
Identities = 75/140 (53%), Positives = 110/140 (78%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFG+ ++L G G +GKF+P+ +++QF++GL+GW + ++K LY++G G+ + D++
Sbjct: 158 AFGSFIILAGFTLGFMGKFTPEAINLQFSRGLIGWALQIVILKGLLYSMGGGEVPLLDLV 217

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGY F G+SL+V++R+LW YSY+V+MP SLCM VFLV+TMKRV+F E+RS ER S+R
Sbjct: 218 AYGGYLFAGLSLAVVSRLLWAYSYFVMMPWMSLCMGVFLVRTMKRVLFTEMRSSERHSTR 277

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HY LLF+A+AQFPL WLG
Sbjct: 278 QHYFLLFLAIAQFPLFFWLG 297


>tr|B4FPP0|B4FPP0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 267

Score = 177 bits (450), Expect = 2e-43
Identities = 77/140 (55%), Positives = 108/140 (77%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFG+ ++L G G +GKF+P+ +++QFT+ L+GW T++K LY++G G+ + D++
Sbjct: 124 AFGSFIILSGFTLGFMGKFTPEAINLQFTRALIGWGFQLTVLKGLLYSMGGGEVPLLDLV 183

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGY F G+SL+V+AR++W YSYYV+MP SLCM VFLV+TMKRV+F E+RS ER SSR
Sbjct: 184 AYGGYLFAGLSLAVVARLMWAYSYYVMMPWMSLCMGVFLVRTMKRVLFTEMRSSERHSSR 243

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HY LLF+A+ QFPL WLG
Sbjct: 244 QHYFLLFMAIVQFPLFFWLG 263


>tr|B6STI1|B6STI1_MAIZE Protein YIF1A OS=Zea mays PE=2 SV=1
Length = 267

Score = 177 bits (449), Expect = 3e-43
Identities = 77/140 (55%), Positives = 108/140 (77%)
Frame = +2

Query: 2 AFGTHVVLCGIASGLLGKFSPDVLSIQFTKGLLGWLVNATLIKLSLYALGNGDAAIFDIL 181
AFG+ ++L G G +GKF+P+ +++QFT+ L+GW T++K LY++G G+ + D++
Sbjct: 124 AFGSFIILSGFTLGFMGKFTPEAINLQFTRALIGWGFQLTVLKGLLYSMGGGEVPLLDLV 183

Query: 182 SYGGYAFVGVSLSVMARMLWHYSYYVLMPLTSLCMAVFLVKTMKRVVFAEVRSYERDSSR 361
+YGGY F G+SL+V+AR++W YSYYV+MP SLCM VFLV+TMKRV+F E+RS ER SSR
Sbjct: 184 AYGGYLFAGLSLAVVARLVWAYSYYVMMPWMSLCMGVFLVRTMKRVLFTEMRSSERHSSR 243

Query: 362 HHYLLLFIAVAQFPLSLWLG 421
HY LLF+A+ QFPL WLG
Sbjct: 244 QHYFLLFMAIVQFPLFFWLG 263