BP920105
Clone id YMU001_000133_A11
Library
Length 573
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000133_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATAGAGTACTACGGGAGTGTTCAAAGTTGGTGAATCAACCTAAAAGAACTCCCTTCTGT
TGGTGGGGCCGGTACATTTTGTAAGGGCTAGCTTCTACCAACTATGCTATACCCGGATGA
TGCAGCAACCTCGAAGACATGCTCGACTGCTGGTTTTCCAAAGCCGCATCCAAGTGCCAG
TTTCATAAATCCTTGGAAGCATGTATTAAGGCTTTATCATGGTCATACGAGTAAGTGTGT
TGCCACGCTCAGACGCAGAGTGCTGGATAATATTCAGCAATTTGTTTTCAATGAGAGAGC
GTCGAAATGAAGAAAGAGGCTCTCAAGAAATTGTTGTAAGCAAGTAATTTATGAACGCAA
CATAAAGCTTGCGCATACCAGGTTGGGGGTTTTGTCAGTTCACTACTTGAGAGAGGATGA
AAGTGTAGTGCCATCACTCTCTTGCAAATAGTTTTGGGTTTTTTACTTGGTTTTTTTGGT
GCCTTAAGATGGCCATAAAGTGCACTATGCACTTTGAATTTAAATGAAAGATTCAAGTGT
GAAAAGAGCATTTGAGTACCTGCAGGTAATATC
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920105|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_A11.
(573 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id B0SRR3
Definition tr|B0SRR3|B0SRR3_LEPBP Putative glucose-fructose oxidoreductase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
Align length 61
Score (bit) 35.4
E-value 2.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920105|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_A11.
(573 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0SRR3|B0SRR3_LEPBP Putative glucose-fructose oxidoreductase ... 35 2.3
tr|B0S979|B0S979_LEPBA Oxidoreductase, NAD-binding OS=Leptospira... 35 2.3
tr|B6L1V5|B6L1V5_BRAFL Putative uncharacterized protein (Fragmen... 34 6.6
tr|A8B7C9|A8B7C9_GIALA Phosphatidylinositol-3,4,5-trisphosphate ... 34 6.6

>tr|B0SRR3|B0SRR3_LEPBP Putative glucose-fructose oxidoreductase
OS=Leptospira biflexa serovar Patoc (strain Patoc 1 /
ATCC 23582 / Paris) GN=LEPBI_I1752 PE=4 SV=1
Length = 346

Score = 35.4 bits (80), Expect = 2.3
Identities = 20/61 (32%), Positives = 33/61 (54%)
Frame = +2

Query: 95 LPTMLYPDDAATSKTCSTAGFPKPHPSASFINPWKHVLRLYHGHTSKCVATLRRRVLDNI 274
+P+ LY + +T FPKP S +F+ +K + ++HG T++ A+L DNI
Sbjct: 278 VPSKLY-QGFRSLETYQPKDFPKPESSNAFLGIYKEIKEVFHGETTRMEASL----ADNI 332

Query: 275 Q 277
Q
Sbjct: 333 Q 333


>tr|B0S979|B0S979_LEPBA Oxidoreductase, NAD-binding OS=Leptospira
biflexa serovar Patoc (strain Patoc 1 / Ames)
GN=LBF_1699 PE=4 SV=1
Length = 346

Score = 35.4 bits (80), Expect = 2.3
Identities = 20/61 (32%), Positives = 33/61 (54%)
Frame = +2

Query: 95 LPTMLYPDDAATSKTCSTAGFPKPHPSASFINPWKHVLRLYHGHTSKCVATLRRRVLDNI 274
+P+ LY + +T FPKP S +F+ +K + ++HG T++ A+L DNI
Sbjct: 278 VPSKLY-QGFRSLETYQPKDFPKPESSNAFLGIYKEIKEVFHGETTRMEASL----ADNI 332

Query: 275 Q 277
Q
Sbjct: 333 Q 333


>tr|B6L1V5|B6L1V5_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_201173 PE=4 SV=1
Length = 470

Score = 33.9 bits (76), Expect = 6.6
Identities = 24/106 (22%), Positives = 44/106 (41%), Gaps = 6/106 (5%)
Frame = +2

Query: 167 HPSASFINPWKHVLRLYH------GHTSKCVATLRRRVLDNIQQFVFNERASK*RKRLSR 328
HP+ S+ + WKHV ++ H T + +A+LR R + ++ + SR
Sbjct: 259 HPNGSWEDEWKHVEQMLHCVAGMVDKTLRAIASLRHRSVQEREEMLM----------WSR 308

Query: 329 NCCKQVIYERNIKLAHTRLGVLSVHYLREDESVVPSLSCK*FWVFY 466
C + +E R G + H +R+ E V + + W +
Sbjct: 309 RCAEGADHEMK-----KRAGEMMAHTIRQTEDRVSEVKRRAGWYIF 349


>tr|A8B7C9|A8B7C9_GIALA Phosphatidylinositol-3,4,5-trisphosphate
3-phosphatase OS=Giardia lamblia ATCC 50803
GN=GL50803_16728 PE=4 SV=1
Length = 532

Score = 33.9 bits (76), Expect = 6.6
Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
Frame = +2

Query: 146 TAGFPKPHPSASFINPWKHVLRLYHG-HTSK-CVATLRRRVLDNIQQFVFNERAS 304
T G+P ASF NP KHVLRL++ H K V L V +FN R S
Sbjct: 73 TMGYPATSIEASFRNPVKHVLRLFNSVHAEKYWVFNLCSEVKRRYHPSLFNNRVS 127