BP920113
Clone id YMU001_000133_B09
Library
Length 402
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000133_B09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCGGAAATAAACCGTTCCGCAGAAAAATCATAAAATTTCGTCCACAGTGACAACTCTTTG
CTACAAAATCAGCTGCCAAAATTTAGAATCAGCCCCTAGCACAAAAGGGGTGCGATTTAA
AGGACATCGAAGCATGCCTACTGAGATGATCCATGGACTTTACCATTGATAAATGCTCGC
AACAAGGGTATCAATCCTACTAAAGCCATTTGCACCTGCTCTGAACTGCTTGCTCATATA
CTGATCTGGCCAGCCCCCCGGTTGTTCAAATTCACTCTACCAATGAAAACCATCTTGCCC
ACCTAAATCTGTATTTGCGAATTGCCACCTATTGCAAAGTCTCCATGCCAATTCATGACC
GAAAGCCCAAAGGATGAGAAAGAGCGATCTATGGGATAATCT
■■Homology search results ■■ -
sp_hit_id Q9LUS2
Definition sp|Q9LUS2|TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana
Align length 79
Score (bit) 70.5
E-value 2.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920113|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_B09.
(402 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LUS2|TC120_ARATH Translocase of chloroplast 120, chloroplas... 70 2e-12
sp|Q9SLF3|TC132_ARATH Translocase of chloroplast 132, chloroplas... 69 6e-12
sp|O81283|TC159_ARATH Translocase of chloroplast 159, chloroplas... 54 3e-07
sp|A6L1Q8|TYSY_BACV8 Thymidylate synthase OS=Bacteroides vulgatu... 30 2.8
sp|A2A8T7|CA223_MOUSE Uncharacterized protein C1orf223 homolog O... 30 4.8
sp|Q8A639|TYSY_BACTN Thymidylate synthase OS=Bacteroides thetaio... 29 8.2

>sp|Q9LUS2|TC120_ARATH Translocase of chloroplast 120, chloroplastic
OS=Arabidopsis thaliana GN=TOC120 PE=1 SV=1
Length = 1089

Score = 70.5 bits (171), Expect = 2e-12
Identities = 36/79 (45%), Positives = 48/79 (60%), Gaps = 1/79 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMV-FIGRVNLNNRXXXXXXXXXXX 225
DYP+ R S+ GLSVM+WHGD AIGGN Q Q+ +G+ I R NLNNR
Sbjct: 999 DYPLGRFLSTLGLSVMDWHGDLAIGGNIQSQVPIGRSSNLIARANLNNRGAGQVSIRVNS 1058

Query: 224 XXQVQMALVGLIPLLRAFI 168
Q+Q+A+V L+PL + +
Sbjct: 1059 SEQLQLAVVALVPLFKKLL 1077


>sp|Q9SLF3|TC132_ARATH Translocase of chloroplast 132, chloroplastic
OS=Arabidopsis thaliana GN=TOC132 PE=1 SV=1
Length = 1206

Score = 69.3 bits (168), Expect = 6e-12
Identities = 34/80 (42%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMV-FIGRVNLNNRXXXXXXXXXXX 225
DYP+ R ++ GLSVM+WHGD AIGGN Q Q+ +G+ I R NLNNR
Sbjct: 1117 DYPLGRFLTTLGLSVMDWHGDLAIGGNIQSQVPIGRSSNLIARANLNNRGAGQVSVRVNS 1176

Query: 224 XXQVQMALVGLIPLLRAFIN 165
Q+Q+A+V ++PL + ++
Sbjct: 1177 SEQLQLAMVAIVPLFKKLLS 1196


>sp|O81283|TC159_ARATH Translocase of chloroplast 159, chloroplastic
OS=Arabidopsis thaliana GN=TOC159 PE=1 SV=1
Length = 1503

Score = 53.5 bits (127), Expect = 3e-07
Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIG-RVNLNNRXXXXXXXXXXX 225
D+PI + SSFGLS++ W GD A+G N Q Q+ VG+ I R LNN+
Sbjct: 1410 DFPIGQDQSSFGLSLVKWRGDLALGANLQSQVSVGRNSKIALRAGLNNKMSGQITVRTSS 1469

Query: 224 XXQVQMALVGLIPL 183
Q+Q+AL ++P+
Sbjct: 1470 SDQLQIALTAILPI 1483


>sp|A6L1Q8|TYSY_BACV8 Thymidylate synthase OS=Bacteroides vulgatus
(strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=thyA PE=3
SV=1
Length = 264

Score = 30.4 bits (67), Expect = 2.8
Identities = 15/34 (44%), Positives = 19/34 (55%)
Frame = -1

Query: 342 RLCNRWQFANTDLGGQDGFHW*SEFEQPGGWPDQ 241
R+ N W AN DLG G+ W S + GG+ DQ
Sbjct: 78 RIWNEWADANGDLGHIYGYQWRSWPDYNGGFIDQ 111


>sp|A2A8T7|CA223_MOUSE Uncharacterized protein C1orf223 homolog
OS=Mus musculus PE=2 SV=1
Length = 201

Score = 29.6 bits (65), Expect = 4.8
Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 10/73 (13%)
Frame = +1

Query: 145 DDPWTLPLINARNKGINPTKAICTCSELLAHILIWP-APRLFK---------FTLPMKTI 294
D W L L RN + + S+LL H+L P P+ K F LP+
Sbjct: 88 DSLWELDLSEGRNFVVQDSSPRGEASDLLQHVLGIPKQPQSSKMSQPRTDSPFPLPIFQE 147

Query: 295 LPT*ICICELPPI 333
+P + +C LPP+
Sbjct: 148 VPFALSLCHLPPM 160


>sp|Q8A639|TYSY_BACTN Thymidylate synthase OS=Bacteroides
thetaiotaomicron GN=thyA PE=3 SV=1
Length = 264

Score = 28.9 bits (63), Expect = 8.2
Identities = 14/34 (41%), Positives = 18/34 (52%)
Frame = -1

Query: 342 RLCNRWQFANTDLGGQDGFHW*SEFEQPGGWPDQ 241
R+ N W N DLG G+ W S + GG+ DQ
Sbjct: 78 RIWNEWADENGDLGHIYGYQWRSWPDYDGGFIDQ 111


tr_hit_id Q6RJN8
Definition tr|Q6RJN8|Q6RJN8_PHYPA Chloroplast Toc125 OS=Physcomitrella patens
Align length 79
Score (bit) 86.3
E-value 7.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920113|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_B09.
(402 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6RJN8|Q6RJN8_PHYPA Chloroplast Toc125 OS=Physcomitrella pate... 86 7e-16
tr|A9SY65|A9SY65_PHYPA Predicted protein OS=Physcomitrella paten... 86 7e-16
tr|A9SY64|A9SY64_PHYPA Predicted protein OS=Physcomitrella paten... 86 7e-16
tr|A9SV60|A9SV60_PHYPA Predicted protein OS=Physcomitrella paten... 86 7e-16
tr|A9SV59|A9SV59_PHYPA Predicted protein OS=Physcomitrella paten... 86 7e-16
tr|A7P885|A7P885_VITVI Chromosome chr3 scaffold_8, whole genome ... 78 2e-13
tr|Q94LU7|Q94LU7_ORYSJ Os10g0548800 protein OS=Oryza sativa subs... 58 3e-07
tr|A2Z9Z4|A2Z9Z4_ORYSI Putative uncharacterized protein OS=Oryza... 58 3e-07
tr|Q65XQ8|Q65XQ8_ORYSJ Putative chloroplast outer envelope 86-li... 57 6e-07
tr|Q0DKN6|Q0DKN6_ORYSJ Os05g0151400 protein OS=Oryza sativa subs... 57 6e-07
tr|A3B021|A3B021_ORYSJ Putative uncharacterized protein OS=Oryza... 57 6e-07
tr|B8AY53|B8AY53_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A7Q0A2|A7Q0A2_VITVI Chromosome chr7 scaffold_42, whole genome... 55 2e-06
tr|A7NW30|A7NW30_VITVI Chromosome chr5 scaffold_2, whole genome ... 51 3e-05
tr|Q9LKR1|Q9LKR1_PEA Chloroplast protein import component Toc159... 50 6e-05
tr|Q7DLK2|Q7DLK2_PEA Chloroplast outer envelope protein 86 OS=Pi... 50 6e-05
tr|Q41010|Q41010_PEA GTP-binding protein OS=Pisum sativum GN=IAP... 50 6e-05
tr|Q00UR2|Q00UR2_OSTTA Putative outer envelope protein [Oryza sa... 44 0.004
tr|Q5ZBJ3|Q5ZBJ3_ORYSJ Putative OEP86=outer envelope protein OS=... 40 0.075
tr|B8A7W5|B8A7W5_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.075
tr|A4S7Z0|A4S7Z0_OSTLU Predicted protein (Fragment) OS=Ostreococ... 39 0.13
tr|A8NKM0|A8NKM0_COPC7 Predicted protein OS=Coprinopsis cinerea ... 33 9.4

>tr|Q6RJN8|Q6RJN8_PHYPA Chloroplast Toc125 OS=Physcomitrella patens
PE=2 SV=1
Length = 1141

Score = 86.3 bits (212), Expect = 7e-16
Identities = 40/79 (50%), Positives = 53/79 (67%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIGRVNLNNRXXXXXXXXXXXX 222
+YP+ R+ S+ GLSVM+WHGD AIGGN Q Q VGK + +GR NLNNR
Sbjct: 1052 EYPLSRTLSTLGLSVMDWHGDLAIGGNLQSQFMVGKTMMVGRANLNNRGSGQVSIRASSS 1111

Query: 221 XQVQMALVGLIPLLRAFIN 165
Q+QM L+G++P+LR+ IN
Sbjct: 1112 EQLQMVLIGIVPILRSLIN 1130


>tr|A9SY65|A9SY65_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_189669 PE=4 SV=1
Length = 994

Score = 86.3 bits (212), Expect = 7e-16
Identities = 40/79 (50%), Positives = 53/79 (67%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIGRVNLNNRXXXXXXXXXXXX 222
+YP+ R+ S+ GLSVM+WHGD AIGGN Q Q VGK + +GR NLNNR
Sbjct: 905 EYPLSRTLSTLGLSVMDWHGDLAIGGNLQSQFMVGKTMMVGRANLNNRGSGQVSIRASSS 964

Query: 221 XQVQMALVGLIPLLRAFIN 165
Q+QM L+G++P+LR+ IN
Sbjct: 965 EQLQMVLIGIVPILRSLIN 983


>tr|A9SY64|A9SY64_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_216964 PE=4 SV=1
Length = 1141

Score = 86.3 bits (212), Expect = 7e-16
Identities = 40/79 (50%), Positives = 53/79 (67%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIGRVNLNNRXXXXXXXXXXXX 222
+YP+ R+ S+ GLSVM+WHGD AIGGN Q Q VGK + +GR NLNNR
Sbjct: 1052 EYPLSRTLSTLGLSVMDWHGDLAIGGNLQSQFMVGKTMMVGRANLNNRGSGQVSIRASSS 1111

Query: 221 XQVQMALVGLIPLLRAFIN 165
Q+QM L+G++P+LR+ IN
Sbjct: 1112 EQLQMVLIGIVPILRSLIN 1130


>tr|A9SV60|A9SV60_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_188734 PE=4 SV=1
Length = 1149

Score = 86.3 bits (212), Expect = 7e-16
Identities = 40/79 (50%), Positives = 53/79 (67%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIGRVNLNNRXXXXXXXXXXXX 222
+YP+ R+ S+ GLSVM+WHGD AIGGN Q Q VGK + +GR NLNNR
Sbjct: 1059 EYPLSRTLSTLGLSVMDWHGDLAIGGNLQSQFMVGKTMMVGRANLNNRGSGQVSIRASSS 1118

Query: 221 XQVQMALVGLIPLLRAFIN 165
Q+QM L+G++P+LR+ IN
Sbjct: 1119 EQLQMVLIGIVPILRSLIN 1137


>tr|A9SV59|A9SV59_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_216050 PE=4 SV=1
Length = 919

Score = 86.3 bits (212), Expect = 7e-16
Identities = 40/79 (50%), Positives = 53/79 (67%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMVFIGRVNLNNRXXXXXXXXXXXX 222
+YP+ R+ S+ GLSVM+WHGD AIGGN Q Q VGK + +GR NLNNR
Sbjct: 829 EYPLSRTLSTLGLSVMDWHGDLAIGGNLQSQFMVGKTMMVGRANLNNRGSGQVSIRASSS 888

Query: 221 XQVQMALVGLIPLLRAFIN 165
Q+QM L+G++P+LR+ IN
Sbjct: 889 EQLQMVLIGIVPILRSLIN 907


>tr|A7P885|A7P885_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036085001
PE=4 SV=1
Length = 1275

Score = 78.2 bits (191), Expect = 2e-13
Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMV-FIGRVNLNNRXXXXXXXXXXX 225
D+P+ RS S+ GLS+M+WHGD AIG N Q QI +G+ IGRVNLNNR
Sbjct: 1187 DHPLGRSLSTLGLSIMDWHGDLAIGCNIQSQIPIGRFTNMIGRVNLNNRGAGQVSIRLNS 1246

Query: 224 XXQVQMALVGLIPLLRAFINGKVHG 150
Q+Q+AL+GL+PLLR + G
Sbjct: 1247 SEQLQIALIGLVPLLRKLLGYSQQG 1271


>tr|Q94LU7|Q94LU7_ORYSJ Os10g0548800 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0082M15.3 PE=4 SV=1
Length = 1008

Score = 57.8 bits (138), Expect = 3e-07
Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMV-FIGRVNLNNRXXXXXXXXXXX 225
DYPI R S+ LSV++WHGD A+G N Q QI G+ IG NL+N+
Sbjct: 925 DYPIGRMLSTIALSVVDWHGDLAVGCNIQSQIPAGRASNLIGHANLSNKGTGQVGIRLNS 984

Query: 224 XXQVQMALVGLIPL 183
+++AL+ L+P+
Sbjct: 985 SEHLEIALIALVPI 998


>tr|A2Z9Z4|A2Z9Z4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_34561 PE=4 SV=1
Length = 1008

Score = 57.8 bits (138), Expect = 3e-07
Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 1/74 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGKMV-FIGRVNLNNRXXXXXXXXXXX 225
DYPI R S+ LSV++WHGD A+G N Q QI G+ IG NL+N+
Sbjct: 925 DYPIGRMLSTIALSVVDWHGDLAVGCNIQSQIPAGRTSNLIGHANLSNKGTGQVGIRLNS 984

Query: 224 XXQVQMALVGLIPL 183
+++AL+ L+P+
Sbjct: 985 SEHLEIALIALVPI 998


>tr|Q65XQ8|Q65XQ8_ORYSJ Putative chloroplast outer envelope 86-like
protein (Putative chloroplast outer membrane protein)
OS=Oryza sativa subsp. japonica GN=OSJNBa0072C16.3 PE=4
SV=1
Length = 1118

Score = 56.6 bits (135), Expect = 6e-07
Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGK-MVFIGRVNLNNRXXXXXXXXXXX 225
DYPI +S S+ GLS+M W D A+G N Q Q +G+ + R+ LNN+
Sbjct: 1028 DYPIGQSLSTLGLSLMKWRRDLALGANLQSQFSIGRGSKMVVRLGLNNKLSGQITVRTST 1087

Query: 224 XXQVQMALVGLIPL 183
QVQ+AL+GLIP+
Sbjct: 1088 SEQVQIALLGLIPV 1101


>tr|Q0DKN6|Q0DKN6_ORYSJ Os05g0151400 protein OS=Oryza sativa subsp.
japonica GN=Os05g0151400 PE=4 SV=1
Length = 1306

Score = 56.6 bits (135), Expect = 6e-07
Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
Frame = -2

Query: 401 DYPIDRSFSSFGLSVMNWHGDFAIGGNSQIQI*VGK-MVFIGRVNLNNRXXXXXXXXXXX 225
DYPI +S S+ GLS+M W D A+G N Q Q +G+ + R+ LNN+
Sbjct: 1216 DYPIGQSLSTLGLSLMKWRRDLALGANLQSQFSIGRGSKMVVRLGLNNKLSGQITVRTST 1275

Query: 224 XXQVQMALVGLIPL 183
QVQ+AL+GLIP+
Sbjct: 1276 SEQVQIALLGLIPV 1289