BP920116
Clone id YMU001_000133_C01
Library
Length 558
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000133_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTTTTGCAAGCGTTGCAGCTCGTACTGGCCTTTGATCTGCCATTAGCATGATAGAGCTCC
TCACATCCTCCCACCTGTAGCTGCAGCCCCTTCCTCGTTGGTTTCCCTAGCCTCATCCTT
CACATACTCCTCAATCAAGGTCTGCTGTCGCTGACTCAGACTCGTTGGGATGGTGACTTG
GAAATGGATAAATTGATCACCCGCAAATGCAGAATTTACAGCTCGGATACCTCTATTCCT
CAAAACTTCCTTATGACCATGCTGTGTTCCTGGCCGTACCTTAAGTATCACGTCACCACT
GAGGGTGGGCACTTGTGCTTTACCTCCAAGAATAGCCGTAGCAAAAGAGATGGGTATGTC
AACATGGACATTGCTTCCTTCTCGCCTAAATACAGGGTCTGGTAGAACCTTAATTATAAC
AAAAACATCTCCTGGAACACGGGACTGTGCTGAGTAGCCGCCACCTCCAGGCACACGTAC
GGTGTTATCATTATCAACGCCAGCTGGAATACTGGCTGACACAGACTTCCTGGCTTTAAC
AGTACCCTTTCCACTGCA
■■Homology search results ■■ -
sp_hit_id Q0AIY0
Definition sp|Q0AIY0|DNAJ_NITEC Chaperone protein dnaJ OS=Nitrosomonas eutropha (strain C91)
Align length 145
Score (bit) 128.0
E-value 2.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920116|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_C01.
(558 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0AIY0|DNAJ_NITEC Chaperone protein dnaJ OS=Nitrosomonas eutr... 128 2e-29
sp|A6T225|DNAJ_JANMA Chaperone protein dnaJ OS=Janthinobacterium... 127 4e-29
sp|O06431|DNAJ_NITEU Chaperone protein dnaJ OS=Nitrosomonas euro... 126 8e-29
sp|Q3SIN3|DNAJ_THIDA Chaperone protein dnaJ OS=Thiobacillus deni... 125 1e-28
sp|Q1H3B9|DNAJ_METFK Chaperone protein dnaJ OS=Methylobacillus f... 125 1e-28
sp|A4G8D1|DNAJ_HERAR Chaperone protein dnaJ OS=Herminiimonas ars... 125 2e-28
sp|P87239|MDJ1_SCHPO DnaJ homolog 1, mitochondrial OS=Schizosacc... 124 4e-28
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein dnaJ OS=Burkholderia mult... 124 4e-28
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein dnaJ OS=Burkholderia thai... 123 5e-28
sp|A4IR30|DNAJ_GEOTN Chaperone protein dnaJ OS=Geobacillus therm... 123 7e-28
sp|A4JBS2|DNAJ_BURVG Chaperone protein dnaJ OS=Burkholderia viet... 123 7e-28
sp|Q0BI17|DNAJ_BURCM Chaperone protein dnaJ OS=Burkholderia ambi... 123 7e-28
sp|A0K4S9|DNAJ_BURCH Chaperone protein dnaJ OS=Burkholderia ceno... 123 7e-28
sp|Q1BYX2|DNAJ_BURCA Chaperone protein dnaJ OS=Burkholderia ceno... 123 7e-28
sp|Q38813|DNAJ1_ARATH Chaperone protein dnaJ 1, mitochondrial OS... 123 7e-28
sp|Q39JC7|DNAJ_BURS3 Chaperone protein dnaJ OS=Burkholderia sp. ... 122 9e-28
sp|A1KR91|DNAJ_NEIMF Chaperone protein dnaJ OS=Neisseria meningi... 122 1e-27
sp|P63969|DNAJ_NEIMB Chaperone protein dnaJ OS=Neisseria meningi... 122 1e-27
sp|P63968|DNAJ_NEIMA Chaperone protein dnaJ OS=Neisseria meningi... 122 1e-27
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein dnaJ OS=Neisseria meningi... 122 1e-27
sp|Q892R1|DNAJ_CLOTE Chaperone protein dnaJ OS=Clostridium tetan... 121 3e-27
sp|Q8XW41|DNAJ_RALSO Chaperone protein dnaJ OS=Ralstonia solanac... 120 3e-27
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein dnaJ OS=Clostridium perfr... 120 3e-27
sp|A7Z6W0|DNAJ_BACA2 Chaperone protein dnaJ OS=Bacillus amyloliq... 120 3e-27
sp|Q8L397|DNAJ_ACHLA Chaperone protein dnaJ OS=Acholeplasma laid... 120 3e-27
sp|Q1LJ82|DNAJ_RALME Chaperone protein dnaJ OS=Ralstonia metalli... 120 5e-27
sp|Q48E63|DNAJ_PSE14 Chaperone protein dnaJ OS=Pseudomonas syrin... 120 5e-27
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein dnaJ OS=Geobacillus kaust... 120 5e-27
sp|A1V0U8|DNAJ_BURMS Chaperone protein dnaJ OS=Burkholderia mall... 120 5e-27
sp|Q62HD6|DNAJ_BURMA Chaperone protein dnaJ OS=Burkholderia mall... 120 5e-27

>sp|Q0AIY0|DNAJ_NITEC Chaperone protein dnaJ OS=Nitrosomonas
eutropha (strain C91) GN=dnaJ PE=3 SV=1
Length = 369

Score = 128 bits (322), Expect = 2e-29
Identities = 64/145 (44%), Positives = 91/145 (62%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK K++S IPAGVD +++R+ G G A + GD++V+I + PVF+RE
Sbjct: 197 CQGAGRVKRHKTLSVRIPAGVDEGDSIRLTGEGEAGASGGLAGDLYVVIHLASHPVFQRE 256

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G+++H +IPISF A LGG+ +VPTL G +KV GTQ G LR++GI V + G
Sbjct: 257 GNHLHCEIPISFTVAALGGEIEVPTLDGHARIKVPTGTQTGKIFRLRSKGITGVRNQSTG 316

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
D H V P +L+ RQ+ L+EE+
Sbjct: 317 DLLCHVAVETPVNLTPRQKELLEEF 341


>sp|A6T225|DNAJ_JANMA Chaperone protein dnaJ OS=Janthinobacterium
sp. (strain Marseille) GN=dnaJ PE=3 SV=1
Length = 374

Score = 127 bits (319), Expect = 4e-29
Identities = 60/145 (41%), Positives = 91/145 (62%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
CSG G +K K++ IP+G+D+ +R G G PGD++V I++ P+F+R+
Sbjct: 203 CSGAGKIKRNKTLEVKIPSGIDDGMRIRSSGNGEPGMNGGPPGDLYVEIRIKQHPMFQRD 262

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++H +IPISFA A LGG+ +VPTL+G + GTQ G LR++GI+ V S +AG
Sbjct: 263 GDDLHCEIPISFAKAALGGEIEVPTLNGKASFTIPEGTQSGKTFRLRSKGIKGVRSGYAG 322

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
D F H V P +L++RQ+ L+ E+
Sbjct: 323 DLFCHVIVETPVTLTERQKELMREF 347


>sp|O06431|DNAJ_NITEU Chaperone protein dnaJ OS=Nitrosomonas
europaea GN=dnaJ PE=3 SV=2
Length = 369

Score = 126 bits (316), Expect = 8e-29
Identities = 63/145 (43%), Positives = 90/145 (62%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK +K++S IPAGVD +++R+ G G A GD++++I + PVF+RE
Sbjct: 197 CHGAGWVKRQKTLSVRIPAGVDEGDSIRLTGEGEAGANGGQAGDLYIVIHLASHPVFQRE 256

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G+++H +IPISF A LGG+ +VPTL G +KV GTQ G LR++GI V + G
Sbjct: 257 GNHLHCEIPISFTVAALGGEIEVPTLDGHARIKVPAGTQTGKIFRLRSKGITGVRNQSTG 316

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
D H V P L+ RQ+ L+EE+
Sbjct: 317 DLLCHVAVETPVDLTARQKELLEEF 341


>sp|Q3SIN3|DNAJ_THIDA Chaperone protein dnaJ OS=Thiobacillus
denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1
Length = 372

Score = 125 bits (315), Expect = 1e-28
Identities = 61/145 (42%), Positives = 90/145 (62%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G+G VK K++S IPAGVD+ + +R+ G G GD++V+I + PVF+R+
Sbjct: 202 CHGEGRVKKHKTLSVKIPAGVDSGDRIRLAGEGEAGVNGGPSGDLYVVIHLKDHPVFKRD 261

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++H ++PISFATA LGG+ ++PTL G +K+ TQ G LR +GI+ V S G
Sbjct: 262 GDDLHCEMPISFATAALGGEVEIPTLDGHAKIKIPAETQSGKVFRLRGKGIKGVRSHAPG 321

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
D H V P +LS+RQ+ L+ E+
Sbjct: 322 DLLCHMLVETPVNLSERQRELLREF 346


>sp|Q1H3B9|DNAJ_METFK Chaperone protein dnaJ OS=Methylobacillus
flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ
PE=3 SV=1
Length = 373

Score = 125 bits (314), Expect = 1e-28
Identities = 61/144 (42%), Positives = 88/144 (61%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK K++S IPAGVD + +R+ G G PGD++V++ + P+F R+
Sbjct: 202 CHGGGRVKQHKTLSVKIPAGVDEGDRIRLSGEGEAGVNGGPPGDLYVVVHLKKHPIFERD 261

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G+N+H ++PISF TA LGG+ ++PTL G +KV P TQ G LR +GI+ + S G
Sbjct: 262 GANLHCEMPISFTTAALGGEIEIPTLDGHAKMKVPPETQTGAVFRLRGKGIKPLRSNEHG 321

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEE 127
D F H V P L++RQ+ L+ E
Sbjct: 322 DLFCHVIVETPVKLTERQKELLRE 345


>sp|A4G8D1|DNAJ_HERAR Chaperone protein dnaJ OS=Herminiimonas
arsenicoxydans GN=dnaJ PE=3 SV=1
Length = 374

Score = 125 bits (313), Expect = 2e-28
Identities = 59/145 (40%), Positives = 90/145 (62%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
CSG G +K K++ IP+G+D+ +R G G PGD++V I++ +F+RE
Sbjct: 203 CSGAGKIKRNKTLEVKIPSGIDDGMRIRSSGNGEPGMNGGPPGDLYVEIRIKQHAMFQRE 262

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++H +IPISFA A LGG+ +VPTL+G + GTQ G LR++GI+ V S +AG
Sbjct: 263 GDDLHCEIPISFAKAALGGEIEVPTLNGKASFTIPEGTQSGKTFRLRSKGIKGVRSGYAG 322

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
D F H V P +L+++Q+ L+ E+
Sbjct: 323 DLFCHVVVETPVTLTEKQKELLREF 347


>sp|P87239|MDJ1_SCHPO DnaJ homolog 1, mitochondrial
OS=Schizosaccharomyces pombe GN=mdj1 PE=2 SV=1
Length = 528

Score = 124 bits (310), Expect = 4e-28
Identities = 67/152 (44%), Positives = 97/152 (63%), Gaps = 8/152 (5%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGG--------GYSAQSRVPGDVFVIIKVL 403
C G GTV+ RK+VS IP G+D++ +RV G G G +A+SR PGD+F I V
Sbjct: 299 CMGSGTVRERKTVSIDIPPGIDDNTVLRVMGAGNDASTAKGGPNAKSR-PGDLFATIHVR 357

Query: 402 PDPVFRREGSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIR 223
P F REG+NV + I TA LGG +VPTL+G+V L+V PGT G + + +GIR
Sbjct: 358 KHPFFVREGTNVTYNAKIPMTTAALGGTLRVPTLTGNVDLRVSPGTSTGDRITMAGKGIR 417

Query: 222 AVNSAFAGDQFIHFQVTIPTSLSQRQQTLIEE 127
VN++ G+ +++F+VTIP LS +++L+E+
Sbjct: 418 KVNTSRYGNFYVNFEVTIPKILSPHERSLLEQ 449


>sp|Q5NSW9|DNAJ_BURM1 Chaperone protein dnaJ OS=Burkholderia
multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1
Length = 376

Score = 124 bits (310), Expect = 4e-28
Identities = 60/150 (40%), Positives = 88/150 (58%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK K++ IPAG+D+ +R G G PGD++V I + P VF R+
Sbjct: 205 CHGSGKVKETKTLEVKIPAGIDDGMRIRSAGNGEPGINGGPPGDLYVEIHIKPHAVFERD 264

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++H +PI F TA LGG+ +VPTL+G V GTQ G LR +GI+ + S+ AG
Sbjct: 265 GDDLHCQMPIPFTTAALGGEIEVPTLAGRATFPVPEGTQSGKTFRLRGKGIKGLRSSIAG 324

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEA 109
D ++H QV P L++ Q+ L++++ K A
Sbjct: 325 DLYVHVQVETPVKLTEHQRDLLKQFEKSLA 354


>sp|Q2SYZ3|DNAJ_BURTA Chaperone protein dnaJ OS=Burkholderia
thailandensis (strain E264 / ATCC 700388 / DSM 13276 /
CIP 106301) GN=dnaJ PE=3 SV=1
Length = 376

Score = 123 bits (309), Expect = 5e-28
Identities = 60/150 (40%), Positives = 88/150 (58%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK K++ IPAG+D+ +R G G GD++V I + P PVF R+
Sbjct: 205 CHGSGKVKETKTLEVKIPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKPHPVFERD 264

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++H +PI F TA LGG+ +VPTL+G V GTQ G LR +GI+ + S+ AG
Sbjct: 265 GDDLHCQMPIPFTTAALGGEIEVPTLAGRASFTVAEGTQSGKTFRLRGKGIKGLRSSIAG 324

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEA 109
D ++H QV P L+ +Q+ L++++ K A
Sbjct: 325 DLYVHVQVETPVKLTDQQRDLLKQFEKSLA 354


>sp|A4IR30|DNAJ_GEOTN Chaperone protein dnaJ OS=Geobacillus
thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1
Length = 381

Score = 123 bits (308), Expect = 7e-28
Identities = 59/145 (40%), Positives = 89/145 (61%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G G VK RK + IPAGVD+ +RV G G PGD+++I +V P F+R+
Sbjct: 209 CGGTGHVKKRKKIHVKIPAGVDDGQQLRVAGKGEPGVNGGPPGDLYIIFRVQPHEFFKRD 268

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G +++ ++P+SFA A LG + +VPTL GDV LK+ GTQ G + L+ +G+ V G
Sbjct: 269 GDDIYCEVPLSFAQAALGDEIEVPTLHGDVKLKIPAGTQTGTRFRLKGKGVPNVRGYGQG 328

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEY 124
DQ + +V PT L+++Q+ L+ E+
Sbjct: 329 DQHVIVRVVTPTKLTEKQKQLLREF 353


tr_hit_id Q8LEU4
Definition tr|Q8LEU4|Q8LEU4_ARATH DnaJ protein-like OS=Arabidopsis thaliana
Align length 152
Score (bit) 170.0
E-value 6.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920116|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_C01.
(558 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8LEU4|Q8LEU4_ARATH DnaJ protein-like OS=Arabidopsis thaliana... 170 6e-41
tr|Q8L8A1|Q8L8A1_ARATH GFA2 OS=Arabidopsis thaliana GN=GFA2 PE=2... 170 6e-41
tr|Q8GWW8|Q8GWW8_ARATH Putative DnaJ protein OS=Arabidopsis thal... 170 6e-41
tr|A9NVQ6|A9NVQ6_PICSI Putative uncharacterized protein OS=Picea... 170 6e-41
tr|A7QWW9|A7QWW9_VITVI Chromosome chr13 scaffold_210, whole geno... 164 4e-39
tr|Q2QX63|Q2QX63_ORYSJ Os12g0168400 protein OS=Oryza sativa subs... 163 7e-39
tr|B8BND1|B8BND1_ORYSI Putative uncharacterized protein OS=Oryza... 163 7e-39
tr|Q9FI35|Q9FI35_ARATH DnaJ protein-like OS=Arabidopsis thaliana... 162 9e-39
tr|B6TA99|B6TA99_MAIZE Chaperone protein dnaJ OS=Zea mays PE=2 SV=1 159 1e-37
tr|B4FVD3|B4FVD3_MAIZE Putative uncharacterized protein OS=Zea m... 159 1e-37
tr|B4FTR0|B4FTR0_MAIZE Putative uncharacterized protein OS=Zea m... 159 1e-37
tr|Q5VRK6|Q5VRK6_ORYSJ Os06g0116800 protein OS=Oryza sativa subs... 156 8e-37
tr|B8B1N3|B8B1N3_ORYSI Putative uncharacterized protein OS=Oryza... 156 8e-37
tr|A3CFB3|A3CFB3_ORYSJ Putative uncharacterized protein OS=Oryza... 144 3e-33
tr|Q4DLU9|Q4DLU9_TRYCR Chaperone DnaJ protein, putative OS=Trypa... 141 2e-32
tr|Q4D820|Q4D820_TRYCR Chaperone DnaJ protein, putative OS=Trypa... 141 2e-32
tr|Q38EC6|Q38EC6_9TRYP Chaperone protein DNAJ, putative OS=Trypa... 141 2e-32
tr|A4HS91|A4HS91_LEIIN Chaperone protein DNAJ, putative OS=Leish... 138 2e-31
tr|Q54XR6|Q54XR6_DICDI Heat shock protein DnaJ family protein OS... 137 3e-31
tr|A4H3Y7|A4H3Y7_LEIBR Chaperone protein DNAJ, putative OS=Leish... 137 4e-31
tr|A3BNB0|A3BNB0_ORYSJ Putative uncharacterized protein OS=Oryza... 135 2e-30
tr|O97016|O97016_LEIMA Probable heat shock protein dnaJ OS=Leish... 135 2e-30
tr|B7DNC3|B7DNC3_9BACL Chaperone protein DnaJ OS=Alicyclobacillu... 130 6e-29
tr|Q69QB3|Q69QB3_ORYSJ Putative chaperone protein DnaJ OS=Oryza ... 129 1e-28
tr|B8B405|B8B405_ORYSI Putative uncharacterized protein OS=Oryza... 129 1e-28
tr|A3B9P6|A3B9P6_ORYSJ Putative uncharacterized protein OS=Oryza... 129 1e-28
tr|A7CDL8|A7CDL8_BURPI Chaperone protein DnaJ OS=Ralstonia picke... 127 4e-28
tr|B8FGI7|B8FGI7_9DELT Chaperone protein DnaJ OS=Desulfatibacill... 126 7e-28
tr|B1I698|B1I698_DESAP Chaperone protein DnaJ OS=Desulforudis au... 124 3e-27
tr|Q4ITA7|Q4ITA7_AZOVI DnaJ central domain (CXXCXGXG):Heat shock... 124 3e-27

>tr|Q8LEU4|Q8LEU4_ARATH DnaJ protein-like OS=Arabidopsis thaliana
PE=2 SV=1
Length = 456

Score = 170 bits (430), Expect = 6e-41
Identities = 83/152 (54%), Positives = 109/152 (71%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V+ +KSV +I GVDN +T++V GG + PGD++V +KV DPVFRRE
Sbjct: 294 CRGARVVRGQKSVKVNIDPGVDNSDTLKVARVGGADPEGDQPGDLYVTLKVREDPVFRRE 353

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
GS++HVD +S AILGG QVPTL+GDV++KVRPGTQ GHK VLRN+GIRA S G
Sbjct: 354 GSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRARKSTKFG 413

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
DQ++HF V+IP +++QRQ+ L+EE+ K E E
Sbjct: 414 DQYVHFNVSIPANITQRQRELLEEFSKAEQGE 445


>tr|Q8L8A1|Q8L8A1_ARATH GFA2 OS=Arabidopsis thaliana GN=GFA2 PE=2
SV=1
Length = 456

Score = 170 bits (430), Expect = 6e-41
Identities = 83/152 (54%), Positives = 109/152 (71%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V+ +KSV +I GVDN +T++V GG + PGD++V +KV DPVFRRE
Sbjct: 294 CRGARVVRGQKSVKVTIDPGVDNSDTLKVARVGGADPEGDQPGDLYVTLKVREDPVFRRE 353

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
GS++HVD +S AILGG QVPTL+GDV++KVRPGTQ GHK VLRN+GIRA S G
Sbjct: 354 GSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRARKSTKFG 413

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
DQ++HF V+IP +++QRQ+ L+EE+ K E E
Sbjct: 414 DQYVHFNVSIPANITQRQRELLEEFSKAEQGE 445


>tr|Q8GWW8|Q8GWW8_ARATH Putative DnaJ protein OS=Arabidopsis
thaliana GN=At5g48030/MDN11_11 PE=2 SV=1
Length = 456

Score = 170 bits (430), Expect = 6e-41
Identities = 83/152 (54%), Positives = 109/152 (71%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V+ +KSV +I GVDN +T++V GG + PGD++V +KV DPVFRRE
Sbjct: 294 CRGARVVRGQKSVKVTIDPGVDNSDTLKVARVGGADPEGDQPGDLYVTLKVREDPVFRRE 353

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
GS++HVD +S AILGG QVPTL+GDV++KVRPGTQ GHK VLRN+GIRA S G
Sbjct: 354 GSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRARKSTKFG 413

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
DQ++HF V+IP +++QRQ+ L+EE+ K E E
Sbjct: 414 DQYVHFNVSIPANITQRQRELLEEFSKAEQGE 445


>tr|A9NVQ6|A9NVQ6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 463

Score = 170 bits (430), Expect = 6e-41
Identities = 81/152 (53%), Positives = 112/152 (73%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G VK +K + I AG+DND T+RV G GG + PGD+ V IKV DPVFRR+
Sbjct: 302 CGGDRVVKGQKKCTLDIMAGIDNDETLRVLGRGGADPEGGHPGDLLVTIKVREDPVFRRD 361

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G+++HVD IS + AILGG QVPTL+GDV+LKVR GTQHG K L+ +GI++ +S G
Sbjct: 362 GADIHVDENISISQAILGGTIQVPTLTGDVVLKVRQGTQHGQKVALKGKGIKSRHSRHYG 421

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
+Q++HF+V+IPT+++QRQ++LIEE+ K+E R+
Sbjct: 422 NQYVHFRVSIPTNITQRQRSLIEEFAKEENRD 453


>tr|A7QWW9|A7QWW9_VITVI Chromosome chr13 scaffold_210, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00008854001
PE=4 SV=1
Length = 432

Score = 164 bits (414), Expect = 4e-39
Identities = 79/152 (51%), Positives = 106/152 (69%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V+ KSV I GVD++ T++V GG + PGD++V I+V DPVFRRE
Sbjct: 270 CKGDRVVRGSKSVKLDIMPGVDDNETLKVYRSGGADPEGNQPGDLYVTIRVRQDPVFRRE 329

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G ++HVD +S AILGG QVPTL+GDV+LKVRPGTQ G K VL+ +G++ NS G
Sbjct: 330 GPDIHVDAVLSITQAILGGTIQVPTLTGDVVLKVRPGTQPGQKVVLKRKGVKGRNSLSFG 389

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
DQ++HF V+IP++L+QRQ+ LIEE+ K+E E
Sbjct: 390 DQYVHFNVSIPSNLTQRQRQLIEEFAKEEQGE 421


>tr|Q2QX63|Q2QX63_ORYSJ Os12g0168400 protein OS=Oryza sativa subsp.
japonica GN=Os12g0168400 PE=2 SV=1
Length = 419

Score = 163 bits (412), Expect = 7e-39
Identities = 80/152 (52%), Positives = 109/152 (71%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G+ VK +KSV I AG+D+++T++V G GG + PGD++V IK+ DPVFRRE
Sbjct: 259 CKGEQLVKGKKSVKLDIMAGIDDNDTMKVFGKGGADVERNKPGDLYVTIKIREDPVFRRE 318

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G++VHVD IS A A+LGG VPTL+G+V +KVR GTQ G K VLR +GI+A NS G
Sbjct: 319 GNHVHVDAIISIAQAVLGGTVTVPTLTGNVSVKVRQGTQPGEKVVLRGKGIKARNSPAYG 378

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
+Q+IHF V +PT ++QRQ+ L+EE+ K+E E
Sbjct: 379 NQYIHFNVRVPTDVTQRQRELMEEFDKEECNE 410


>tr|B8BND1|B8BND1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37610 PE=4 SV=1
Length = 419

Score = 163 bits (412), Expect = 7e-39
Identities = 80/152 (52%), Positives = 109/152 (71%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G+ VK +KSV I AG+D+++T++V G GG + PGD++V IK+ DPVFRRE
Sbjct: 259 CKGEQLVKGKKSVKLDIMAGIDDNDTMKVFGKGGADVERNKPGDLYVTIKIREDPVFRRE 318

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
G++VHVD IS A A+LGG VPTL+G+V +KVR GTQ G K VLR +GI+A NS G
Sbjct: 319 GNHVHVDAIISIAQAVLGGTVTVPTLTGNVSVKVRQGTQPGEKVVLRGKGIKARNSPAYG 378

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
+Q+IHF V +PT ++QRQ+ L+EE+ K+E E
Sbjct: 379 NQYIHFNVRVPTDVTQRQRELMEEFDKEECNE 410


>tr|Q9FI35|Q9FI35_ARATH DnaJ protein-like OS=Arabidopsis thaliana
PE=4 SV=1
Length = 461

Score = 162 bits (411), Expect = 9e-39
Identities = 83/162 (51%), Positives = 110/162 (67%), Gaps = 10/162 (6%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V+ +KSV +I GVDN +T++V GG + PGD++V +KV DPVFRRE
Sbjct: 289 CRGARVVRGQKSVKVTIDPGVDNSDTLKVARVGGADPEGDQPGDLYVTLKVREDPVFRRE 348

Query: 378 GSNVHVDIPISFA----------TAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRG 229
GS++HVD +S +AILGG QVPTL+GDV++KVRPGTQ GHK VLRN+G
Sbjct: 349 GSDIHVDAVLSVTQHLFWTSGAVSAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKG 408

Query: 228 IRAVNSAFAGDQFIHFQVTIPTSLSQRQQTLIEEYVKDEARE 103
IRA S GDQ++HF V+IP +++QRQ+ L+EE+ K E E
Sbjct: 409 IRARKSTKFGDQYVHFNVSIPANITQRQRELLEEFSKAEQGE 450


>tr|B6TA99|B6TA99_MAIZE Chaperone protein dnaJ OS=Zea mays PE=2 SV=1
Length = 429

Score = 159 bits (401), Expect = 1e-37
Identities = 79/156 (50%), Positives = 105/156 (67%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V RKSV I G+DN++T++V GG R PGD++V ++V DPVFRRE
Sbjct: 265 CRGNKVVPGRKSVRLDILPGLDNEDTIKVVRSGGEDPDGR-PGDLYVTLEVREDPVFRRE 323

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
++HVD ++ AILGG QVPTLSGDV+LKV+PGTQ G K VLR +GI+ NS G
Sbjct: 324 KGDIHVDAVLNVTQAILGGTVQVPTLSGDVVLKVKPGTQPGQKVVLRGKGIKTRNSPHYG 383

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARETNEE 91
DQ++HF V IP +L+ RQ+ LIEE+ K+E E ++
Sbjct: 384 DQYVHFNVNIPENLTSRQRELIEEFAKEEQGEDEKD 419


>tr|B4FVD3|B4FVD3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 429

Score = 159 bits (401), Expect = 1e-37
Identities = 79/156 (50%), Positives = 105/156 (67%)
Frame = -1

Query: 558 CSGKGTVKARKSVSASIPAGVDNDNTVRVPGGGGYSAQSRVPGDVFVIIKVLPDPVFRRE 379
C G V RKSV I G+DN++T++V GG R PGD++V ++V DPVFRRE
Sbjct: 265 CRGNKVVPGRKSVRLDILPGLDNEDTIKVVRSGGEDPDGR-PGDLYVTLEVREDPVFRRE 323

Query: 378 GSNVHVDIPISFATAILGGKAQVPTLSGDVILKVRPGTQHGHKEVLRNRGIRAVNSAFAG 199
++HVD ++ AILGG QVPTLSGDV+LKV+PGTQ G K VLR +GI+ NS G
Sbjct: 324 KGDIHVDAVLNVTQAILGGTVQVPTLSGDVVLKVKPGTQPGQKVVLRGKGIKTRNSPHYG 383

Query: 198 DQFIHFQVTIPTSLSQRQQTLIEEYVKDEARETNEE 91
DQ++HF V IP +L+ RQ+ LIEE+ K+E E ++
Sbjct: 384 DQYVHFNVNIPENLTSRQRELIEEFAKEEQGEDEKD 419