BP920170
Clone id YMU001_000133_H04
Library
Length 186
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000133_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGTCTTGTGAGGGAGACGTTCCCTTTGGACCCTTCCTCCTCAGAGTGGAAAACATTGAAG
GCCCTGCTTGAGCTCCTCATAAGGCTGGGCATTTCTCCTCATCTCAGTCCGGGCGTCGGC
ATCCTAAGAGACAAACATCAAGATGATTGCAGCAACATTTCCTTCCACTTGTCAGGCCTC
TCCATT
■■Homology search results ■■ -
sp_hit_id Q8C3S2
Definition sp|Q8C3S2|TMCO7_MOUSE Transmembrane and coiled-coil domain-containing protein 7 OS=Mus musculus
Align length 35
Score (bit) 36.2
E-value 0.053
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920170|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_H04.
(186 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8C3S2|TMCO7_MOUSE Transmembrane and coiled-coil domain-conta... 36 0.053
sp|Q9C0B7|TMCO7_HUMAN Transmembrane and coiled-coil domain-conta... 34 0.20
sp|Q9SRV0|FB134_ARATH Putative F-box protein At3g03730 OS=Arabid... 29 6.5

>sp|Q8C3S2|TMCO7_MOUSE Transmembrane and coiled-coil
domain-containing protein 7 OS=Mus musculus GN=Tmco7
PE=2 SV=1
Length = 1079

Score = 36.2 bits (82), Expect = 0.053
Identities = 16/35 (45%), Positives = 27/35 (77%), Gaps = 1/35 (2%)
Frame = +1

Query: 34 SSSEWKTLKALLELLIRLGISPHLSPGVGI-LRDK 135
S S+ KT +++L+ ++ LG+ P+L PGVG+ LRD+
Sbjct: 141 SVSQQKTFQSVLQFVVTLGVCPYLIPGVGVPLRDR 175


>sp|Q9C0B7|TMCO7_HUMAN Transmembrane and coiled-coil
domain-containing protein 7 OS=Homo sapiens GN=TMCO7
PE=2 SV=2
Length = 1094

Score = 34.3 bits (77), Expect = 0.20
Identities = 14/30 (46%), Positives = 23/30 (76%)
Frame = +1

Query: 34 SSSEWKTLKALLELLIRLGISPHLSPGVGI 123
S S+ KT++ +L+ ++ LGI P+L PGVG+
Sbjct: 138 SISQQKTVQFVLQFVVTLGICPYLMPGVGV 167


>sp|Q9SRV0|FB134_ARATH Putative F-box protein At3g03730
OS=Arabidopsis thaliana GN=At3g03730 PE=4 SV=1
Length = 393

Score = 29.3 bits (64), Expect = 6.5
Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 2/41 (4%)
Frame = +1

Query: 1 CLVRETFPLDPSSSEWKTLKALLE--LLIRLGISPHLSPGV 117
C V+ + +DP SSEW+ +K++ + L++ LGI+ GV
Sbjct: 288 CFVK-LYKIDPKSSEWRLIKSIGDEALILDLGITVAAKDGV 327


tr_hit_id A9RTL0
Definition tr|A9RTL0|A9RTL0_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 34
Score (bit) 44.3
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920170|Adiantum capillus-veneris mRNA, clone:
YMU001_000133_H04.
(186 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RTL0|A9RTL0_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.003
tr|Q1LUE9|Q1LUE9_DANRE Novel protein (Fragment) OS=Danio rerio G... 37 0.65
tr|B7QM99|B7QM99_IXOSC Putative uncharacterized protein OS=Ixode... 36 0.85
tr|Q4SRQ7|Q4SRQ7_TETNG Chromosome undetermined SCAF14503, whole ... 34 3.2
tr|Q5R5P8|Q5R5P8_PONAB Putative uncharacterized protein DKFZp469... 34 3.2
tr|B6NMI9|B6NMI9_BRAFL Putative uncharacterized protein (Fragmen... 34 3.2
tr|B6MP39|B6MP39_BRAFL Putative uncharacterized protein OS=Branc... 34 3.2
tr|B3L8S5|B3L8S5_PLAKH Elongation factor tu, putative OS=Plasmod... 33 7.2

>tr|A9RTL0|A9RTL0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160902 PE=4 SV=1
Length = 600

Score = 44.3 bits (103), Expect = 0.003
Identities = 21/34 (61%), Positives = 27/34 (79%)
Frame = +1

Query: 34 SSSEWKTLKALLELLIRLGISPHLSPGVGILRDK 135
SSS+ +KA+LEL++R GI PHLSPGVGI +K
Sbjct: 62 SSSDTTVVKAILELVVRWGIYPHLSPGVGIPLEK 95


>tr|Q1LUE9|Q1LUE9_DANRE Novel protein (Fragment) OS=Danio rerio
GN=si:ch211-218c6.2 PE=4 SV=1
Length = 1047

Score = 36.6 bits (83), Expect = 0.65
Identities = 17/37 (45%), Positives = 27/37 (72%), Gaps = 3/37 (8%)
Frame = +1

Query: 22 PLDP---SSSEWKTLKALLELLIRLGISPHLSPGVGI 123
PL P S ++ KTL A+L+ ++ LG+ P+L+PGVG+
Sbjct: 101 PLPPDVLSVAQQKTLGAVLQFVVTLGLCPYLAPGVGV 137


>tr|B7QM99|B7QM99_IXOSC Putative uncharacterized protein OS=Ixodes
scapularis GN=IscW_ISCW014759 PE=4 SV=1
Length = 219

Score = 36.2 bits (82), Expect = 0.85
Identities = 18/37 (48%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
Frame = +1

Query: 22 PLDPSSS---EWKTLKALLELLIRLGISPHLSPGVGI 123
PL PSS + KT++ LL+ ++ LGI P+L PGVG+
Sbjct: 109 PLPPSSLGVLQQKTVQGLLQFVVALGIYPNLLPGVGV 145


>tr|Q4SRQ7|Q4SRQ7_TETNG Chromosome undetermined SCAF14503, whole
genome shotgun sequence OS=Tetraodon nigroviridis
GN=GSTENG00013797001 PE=4 SV=1
Length = 1156

Score = 34.3 bits (77), Expect = 3.2
Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 3/36 (8%)
Frame = +1

Query: 22 PLDP---SSSEWKTLKALLELLIRLGISPHLSPGVG 120
PL P S ++ KTL + L+ ++ LG+ P+L+PGVG
Sbjct: 115 PLSPDVLSVTQQKTLASALQFVVSLGLCPYLAPGVG 150


>tr|Q5R5P8|Q5R5P8_PONAB Putative uncharacterized protein
DKFZp469P1614 OS=Pongo abelii GN=DKFZp469P1614 PE=2 SV=1
Length = 984

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/30 (46%), Positives = 23/30 (76%)
Frame = +1

Query: 34 SSSEWKTLKALLELLIRLGISPHLSPGVGI 123
S S+ KT++ +L+ ++ LGI P+L PGVG+
Sbjct: 139 SISQQKTVQFVLQFVVTLGICPYLMPGVGV 168


>tr|B6NMI9|B6NMI9_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_232484 PE=4 SV=1
Length = 1020

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 3/37 (8%)
Frame = +1

Query: 22 PLDP---SSSEWKTLKALLELLIRLGISPHLSPGVGI 123
PL P S ++ KTL L+ ++ LGI P+L PGVGI
Sbjct: 80 PLSPDTLSIAQQKTLSTALQFVVCLGICPNLLPGVGI 116


>tr|B6MP39|B6MP39_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_124034 PE=4 SV=1
Length = 1112

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 3/37 (8%)
Frame = +1

Query: 22 PLDP---SSSEWKTLKALLELLIRLGISPHLSPGVGI 123
PL P S ++ KTL L+ ++ LGI P+L PGVGI
Sbjct: 140 PLSPDTLSIAQQKTLSTALQFVVCLGICPNLLPGVGI 176


>tr|B3L8S5|B3L8S5_PLAKH Elongation factor tu, putative OS=Plasmodium
knowlesi (strain H) GN=PKH_122210 PE=4 SV=1
Length = 456

Score = 33.1 bits (74), Expect = 7.2
Identities = 16/41 (39%), Positives = 25/41 (60%)
Frame = -2

Query: 131 SLRMPTPGLR*GEMPSLMRSSSRAFNVFHSEEEGSKGNVSL 9
+LR+ PG G +PSL+RS SR ++ S G +GN ++
Sbjct: 7 NLRVVLPG---GGLPSLVRSGSRVVDILGSSHHGGRGNYNI 44