BP920195
Clone id YMU001_000134_B09
Library
Length 418
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_B09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTGTGTGTGTGAGAGCAACACCATCACAAGCTCGCGCTCTCTCTCTATTCTTTGGCTGCA
TCACCCGGCATTGACCTGCTCCATGCCTCGCCCTTCAAATACCGCTATTTCCACTCTCTC
ACTTTGAGCCAGACTTTCCCAATTGCTCGATTATTTGCAGATGCTATGCTTACCTGCACA
CTATGTGTGCCTTCAATGTTCTGCTCGGTATAGCAGTTGTGATTCCTTTCAAGCTTGCCA
ATTTGCTAGTTATGGCTACCCAAATTTCCTGCAAGTTCCAAGAAGTGTGTAATCACCAAT
GCCCGACCCAAGGTCTTCTCAATAGCTTACAATGCCCTCAGATTGTGCTTGGCCGATTCC
TAATGGTTGCCTAATTTTCTGTCTTGAAAATTGTGAGATGCCTCCTCCCTGTGTTGTT
■■Homology search results ■■ -
sp_hit_id P46580
Definition sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans
Align length 85
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920195|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_B09.
(418 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=C... 31 1.7
sp|Q6KAS7|ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus GN... 31 2.2
sp|Q96K83|ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens GN... 31 2.2
sp|Q6NUD7|ZN521_XENLA Zinc finger protein 521 OS=Xenopus laevis ... 30 2.9
sp|Q5T749|KPRP_HUMAN Keratinocyte proline-rich protein OS=Homo s... 30 2.9
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN... 30 3.8
sp|A2BUQ2|TGT_PROM5 Queuine tRNA-ribosyltransferase OS=Prochloro... 30 3.8
sp|A8G2T1|TGT_PROM2 Queuine tRNA-ribosyltransferase OS=Prochloro... 30 4.9
sp|Q5T2D2|TRML2_HUMAN Trem-like transcript 2 protein OS=Homo sap... 29 6.4
sp|A3PAZ2|TGT_PROM0 Queuine tRNA-ribosyltransferase OS=Prochloro... 29 6.4
sp|A2BP70|TGT_PROMS Queuine tRNA-ribosyltransferase OS=Prochloro... 29 8.4
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus... 29 8.4

>sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5
OS=Caenorhabditis elegans GN=prmt-5 PE=2 SV=2
Length = 734

Score = 31.2 bits (69), Expect = 1.7
Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
Frame = -3

Query: 308 GRALVITHFLELAGNLGSHN*QIGKLERNHNCYTEQNIEGTHSVQVSIASANNRAIGKV- 132
GR V+ + L G G +I K ER +N Q E V++ I N AI +
Sbjct: 404 GRKTVVIYLL--GGGRGPIGTKILKSEREYNNTFRQGQESL-KVKLYIVEKNPNAIVTLK 460

Query: 131 WLKVREWK*RYLKGEAWSRSMPGDA 57
++ VR WK R E+ RS+PG A
Sbjct: 461 YMNVRTWKRRVTIIESDMRSLPGIA 485


>sp|Q6KAS7|ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus
GN=Znf521 PE=2 SV=2
Length = 1311

Score = 30.8 bits (68), Expect = 2.2
Identities = 11/17 (64%), Positives = 14/17 (82%)
Frame = +2

Query: 182 YVCLQCSARYSSCDSFQ 232
Y+C QC A+Y+S DSFQ
Sbjct: 634 YICNQCGAKYTSLDSFQ 650


>sp|Q96K83|ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens
GN=ZNF521 PE=1 SV=1
Length = 1311

Score = 30.8 bits (68), Expect = 2.2
Identities = 11/17 (64%), Positives = 14/17 (82%)
Frame = +2

Query: 182 YVCLQCSARYSSCDSFQ 232
Y+C QC A+Y+S DSFQ
Sbjct: 634 YICNQCGAKYTSLDSFQ 650


>sp|Q6NUD7|ZN521_XENLA Zinc finger protein 521 OS=Xenopus laevis
GN=znf521 PE=2 SV=1
Length = 1310

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/21 (52%), Positives = 14/21 (66%)
Frame = +2

Query: 170 LPAHYVCLQCSARYSSCDSFQ 232
L Y+C QC A+Y+S D FQ
Sbjct: 629 LAGEYICNQCGAKYTSLDGFQ 649


>sp|Q5T749|KPRP_HUMAN Keratinocyte proline-rich protein OS=Homo
sapiens GN=KPRP PE=1 SV=1
Length = 579

Score = 30.4 bits (67), Expect = 2.9
Identities = 19/52 (36%), Positives = 21/52 (40%)
Frame = +2

Query: 257 YPNFLQVPRSV*SPMPDPRSSQ*LTMPSDCAWPIPNGCLIFCLENCEMPPPC 412
YP L R P+P PR P C P P CL + CE P PC
Sbjct: 433 YPEPLPALRPTPRPVPLPR-------PGQCEIPEPRPCL----QPCEHPEPC 473


>sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus
GN=Znf271 PE=2 SV=1
Length = 580

Score = 30.0 bits (66), Expect = 3.8
Identities = 19/57 (33%), Positives = 27/57 (47%)
Frame = +2

Query: 44 SILWLHHPALTCSMPRPSNTAISTLSL*ARLSQLLDYLQMLCLPAHYVCLQCSARYS 214
S+L LH T P P N + S RLS L+++ ++ Y C QCS +S
Sbjct: 313 SVLILHQRIHTGEKPYPCNQCTKSFS---RLSDLINHQRIHTGEKPYPCSQCSKMFS 366


>sp|A2BUQ2|TGT_PROM5 Queuine tRNA-ribosyltransferase
OS=Prochlorococcus marinus (strain MIT 9515) GN=tgt PE=3
SV=1
Length = 372

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 7/65 (10%)
Frame = +3

Query: 117 SHFEPDFPNCSIICRCY-------AYLHTMCAFNVLLGIAVVIPFKLANLLVMATQISCK 275
+ F+ DF C+C AYLH + + +LG+ ++ +A+LL IS
Sbjct: 290 ARFKNDFSPIDKTCKCETCKSYSRAYLHHLVRNDEILGLTLISLHNIAHLLRFTNAISAA 349

Query: 276 FQEVC 290
++ C
Sbjct: 350 IKDNC 354


>sp|A8G2T1|TGT_PROM2 Queuine tRNA-ribosyltransferase
OS=Prochlorococcus marinus (strain MIT 9215) GN=tgt PE=3
SV=1
Length = 372

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 7/65 (10%)
Frame = +3

Query: 117 SHFEPDFPNCSIICRCY-------AYLHTMCAFNVLLGIAVVIPFKLANLLVMATQISCK 275
+ F+ DF C+C AYLH + + +LG+ ++ +A+LL IS
Sbjct: 290 ARFKNDFSPIDKTCKCETCKSYSRAYLHHLIRNDEILGLTLISLHNIAHLLRFTNAISTA 349

Query: 276 FQEVC 290
++ C
Sbjct: 350 IKDNC 354


>sp|Q5T2D2|TRML2_HUMAN Trem-like transcript 2 protein OS=Homo
sapiens GN=TREML2 PE=2 SV=2
Length = 321

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
Frame = -3

Query: 197 IEG-THSVQVSIASANNRAIGKVWLKVREWK 108
+EG T SVQ S NR GKVW K+R+ K
Sbjct: 32 LEGETLSVQCSYKGYKNRVEGKVWCKIRKKK 62


>sp|A3PAZ2|TGT_PROM0 Queuine tRNA-ribosyltransferase
OS=Prochlorococcus marinus (strain MIT 9301) GN=tgt PE=3
SV=1
Length = 372

Score = 29.3 bits (64), Expect = 6.4
Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 7/65 (10%)
Frame = +3

Query: 117 SHFEPDFPNCSIICRCY-------AYLHTMCAFNVLLGIAVVIPFKLANLLVMATQISCK 275
+ F+ DF C+C AYLH + + +LG++++ +A+L+ IS
Sbjct: 290 ARFKNDFSPIDKTCKCETCKSYSRAYLHHLIRNDEILGLSLISLHNIAHLIRFTNAISTA 349

Query: 276 FQEVC 290
++ C
Sbjct: 350 IRDNC 354


tr_hit_id Q22RJ4
Definition tr|Q22RJ4|Q22RJ4_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 65
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920195|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_B09.
(418 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q22RJ4|Q22RJ4_TETTH Putative uncharacterized protein OS=Tetra... 35 1.4
tr|Q23RP1|Q23RP1_TETTH Leishmanolysin family protein OS=Tetrahym... 33 7.0
tr|Q22D11|Q22D11_TETTH Putative uncharacterized protein OS=Tetra... 30 8.4

>tr|Q22RJ4|Q22RJ4_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00014940 PE=4
SV=1
Length = 1862

Score = 35.4 bits (80), Expect = 1.4
Identities = 19/65 (29%), Positives = 30/65 (46%)
Frame = +2

Query: 71 LTCSMPRPSNTAISTLSL*ARLSQLLDYLQMLCLPAHYVCLQCSARYSSCDSFQACQFAS 250
L C++PR A +T + +Q LD C P H+ C CS + + Q+C +
Sbjct: 1342 LKCALPRYFQQATNTCEENCQQNQFLDNTDATCEPCHFSCSSCSG--PTNNQCQSCSGSM 1399

Query: 251 YGYPN 265
+ Y N
Sbjct: 1400 FLYQN 1404


>tr|Q23RP1|Q23RP1_TETTH Leishmanolysin family protein OS=Tetrahymena
thermophila SB210 GN=TTHERM_01102690 PE=4 SV=1
Length = 1479

Score = 33.1 bits (74), Expect = 7.0
Identities = 20/84 (23%), Positives = 34/84 (40%)
Frame = +2

Query: 8 CESNTITSSRSLSILWLHHPALTCSMPRPSNTAISTLSL*ARLSQLLDYLQMLCLPAHYV 187
C + SS L + LTCS P+ SN ++ + ++ + + +
Sbjct: 962 CFEDYQISSNGLCTMICDQSCLTCSRPKDSNACLTCKAPSILVNNFCEQCKDGFFYSQGE 1021

Query: 188 CLQCSARYSSCDSFQACQFASYGY 259
C +CS SC++ Q C GY
Sbjct: 1022 CKKCSKNCKSCENEQQCSKCEDGY 1045


>tr|Q22D11|Q22D11_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01006490 PE=4
SV=2
Length = 1669

Score = 30.0 bits (66), Expect(2) = 8.4
Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
Frame = +2

Query: 167 CLPAHYVCLQCSA-RYSSCDSFQACQFASYGYPNFLQ 274
CLP H C +CS Y+ C + CQ +Y + N Q
Sbjct: 1119 CLPCHSSCAECSGPNYNQCTT---CQDKTYKFQNICQ 1152



Score = 21.6 bits (44), Expect(2) = 8.4
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = +3

Query: 273 KFQEVCNHQCP 305
KFQ +C +CP
Sbjct: 1146 KFQNICQTECP 1156