BP920205
Clone id YMU001_000134_C08
Library
Length 470
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGATATTACCTGCAGGTACTCAACTCGCTGCTAGTGAAGACAAAAGTAATGCTTTGTTT
CCTTTGCAAACTGGCTGCGGCATGGCACCCATCAAAGATTAAATGAATGAGATGTTGCAG
TGAGGACCCTTGCAGACCTCCTCCAAAAAAATGATCTCCTTAGTTTGACCATTCAAACAT
CTACTGGTCAAGCATTAAAAGCTTGATATGACTGGTCATGGTTGTTTGTCTGCATCCGCA
TCGAAAGTGCAGCGCTTCTATGATCACCTCCCTTTTGCTGTCCATTTCCTCCGGTGTTTC
TCCAAAAGGGTTTCCTTCTATTAGCTAGTGCTGATGCTATGTAAGGACAAATCAGTTTGC
TCTGACTATTCTGGTGTTTTGAAGCCGGGTTGTAATAGTGGGGCGGGCTTCTATTTTGAG
ACTCTGAAAACACATCTTCGCATTGAACAACTAAATCCACAGCGCAGGTT
■■Homology search results ■■ -
sp_hit_id Q835U8
Definition sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 OS=Enterococcus faecalis
Align length 82
Score (bit) 31.2
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920205|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_C08.
(470 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 OS=Entero... 31 2.4
sp|Q00598|FENR_CYAPA Ferredoxin--NADP reductase, cyanelle OS=Cya... 31 3.1
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativ... 31 3.1
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativ... 31 3.1

>sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2
OS=Enterococcus faecalis GN=infB PE=3 SV=1
Length = 798

Score = 31.2 bits (69), Expect = 2.4
Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
Frame = -2

Query: 427 SESQNRSPPHYYNPASKHQNSQSKLICPYIASALANRRKPFWRNTGGNGQQKGGDHRSAA 248
S +QNRS + N ++++N+Q+ + N+ + N GGN Q +GG +R+
Sbjct: 116 SNTQNRS--NQTNTNNQNRNTQNN------NGSTTNQNRTSQNNNGGNNQNRGGQNRNNN 167

Query: 247 LSMRMQTNN----HDQSYQAFN 194
NN ++Q+ FN
Sbjct: 168 FGGGQNRNNRNNFNNQNRNRFN 189


>sp|Q00598|FENR_CYAPA Ferredoxin--NADP reductase, cyanelle
OS=Cyanophora paradoxa GN=PETH PE=1 SV=1
Length = 363

Score = 30.8 bits (68), Expect = 3.1
Identities = 13/37 (35%), Positives = 20/37 (54%)
Frame = +1

Query: 10 PAGTQLAASEDKSNALFPLQTGCGMAPIKD*MNEMLQ 120
P GT + ED+S + L TG G+AP + + M +
Sbjct: 199 PVGTTMLMPEDQSATIIMLATGTGIAPFRSFLRRMFE 235


>sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa
subsp. japonica GN=CDKG-2 PE=2 SV=2
Length = 710

Score = 30.8 bits (68), Expect = 3.1
Identities = 16/60 (26%), Positives = 28/60 (46%)
Frame = -2

Query: 436 DVFSESQNRSPPHYYNPASKHQNSQSKLICPYIASALANRRKPFWRNTGGNGQQKGGDHR 257
D + +++ H+++P+ +HQ S C A+RR+ R+ GG G HR
Sbjct: 20 DAEASRRSKEQQHHHHPSGRHQRGDSDPRCE------ADRRRDGGRSRGGRELSNGYGHR 73


>sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa
subsp. indica GN=CDKG-2 PE=2 SV=1
Length = 710

Score = 30.8 bits (68), Expect = 3.1
Identities = 16/60 (26%), Positives = 28/60 (46%)
Frame = -2

Query: 436 DVFSESQNRSPPHYYNPASKHQNSQSKLICPYIASALANRRKPFWRNTGGNGQQKGGDHR 257
D + +++ H+++P+ +HQ S C A+RR+ R+ GG G HR
Sbjct: 20 DAEASRRSKEQQHHHHPSGRHQRGDSDPRCE------ADRRRDGGRSRGGRELSNGYGHR 73


tr_hit_id A2ZUA3
Definition tr|A2ZUA3|A2ZUA3_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica
Align length 88
Score (bit) 33.1
E-value 7.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920205|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_C08.
(470 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A2ZUA3|A2ZUA3_ORYSJ Putative uncharacterized protein OS=Oryza... 33 7.1

>tr|A2ZUA3|A2ZUA3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_002125 PE=4 SV=1
Length = 307

Score = 33.1 bits (74), Expect = 7.1
Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 6/88 (6%)
Frame = -2

Query: 463 AVDLVVQCEDVFSESQNRSPPHYYN-PASKHQNSQSKLICPYIASALANR-RKPFWRNT- 293
A + Q + VFS S RSP H N A +HQ+S L P+ R P R T
Sbjct: 169 AKNRAAQMQQVFSASFGRSPVHLRNVHARRHQHSAHLLRIPFPTKRADKRSESPIPRTTP 228

Query: 292 ---GGNGQQKGGDHRSAALSMRMQTNNH 218
G+ QK +++++ ++M T+ H
Sbjct: 229 LTRSGSLPQKPSLLKTSSVRVQMHTSEH 256