BP920216
Clone id YMU001_000134_D07
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCTCCCCCTTGTAAGACCATAAAACAACCCAATGTCGACCAACAAACACAGAAAAAAGGG
TGGTGAGGAGGGCAAAGATGTTTCAATCTGACCTTGCTAATATCCTGTCTAAGAGCTCAC
CTCCCTCGCACAGCCTGCAATCAATACATCCTTGAGTCAGCAGGTTGTACAACACCAGCA
GACGCAAGTCCTGCATCAAAGAACCCTTCATAGACAGACACAGGAAATACTTGAAATCAC
AACATCACTGCTGCCTTACCAATTTGGCTATTTTTACAATCCCCAGGTTTCAATTTTGAA
TACATTGAAAGACCCACATAGGTGGGTTGGCCAATTATCCTCTTCCTCAGGTTTAGGATA
GGCAGAGAAGAAATCATGTTTGATTGCAACAGCCCTGGCAGTGAGAACAACTCCCACGTG
AACGTAACTGTCTCTTTCATGTGAGGGATTCAATCTCCGACATTAATACTCATCAGAAGA
TGCAAAATTATTGTTAAGATTCAATGCAAGTGCTGAACTAGACAACTGAAATTATTTTCT
CAATGTGCATC
■■Homology search results ■■ -
sp_hit_id Q7XJR9
Definition sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana
Align length 16
Score (bit) 34.3
E-value 0.41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920216|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_D07.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Ara... 34 0.41
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Ara... 32 2.0
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota... 31 4.6
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threon... 30 6.0
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membr... 30 7.8

>sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16
OS=Arabidopsis thaliana GN=CPK16 PE=1 SV=1
Length = 571

Score = 34.3 bits (77), Expect = 0.41
Identities = 15/16 (93%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILAR D
Sbjct: 188 LCEGGELLDRILARKD 203


>sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18
OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1
Length = 534

Score = 32.0 bits (71), Expect = 2.0
Identities = 13/16 (81%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LC+GGELLDRILA+ D
Sbjct: 151 LCDGGELLDRILAKKD 166


>sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota
GN=CRK PE=2 SV=1
Length = 602

Score = 30.8 bits (68), Expect = 4.6
Identities = 13/14 (92%), Positives = 14/14 (100%)
Frame = -2

Query: 133 LCEGGELLDRILAR 92
LCEGGELLDRIL+R
Sbjct: 231 LCEGGELLDRILSR 244


>sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent
serine/threonine-protein kinase 1 OS=Oryza sativa subsp.
japonica GN=CAMK1 PE=1 SV=1
Length = 600

Score = 30.4 bits (67), Expect = 6.0
Identities = 13/14 (92%), Positives = 14/14 (100%)
Frame = -2

Query: 133 LCEGGELLDRILAR 92
LC+GGELLDRILAR
Sbjct: 230 LCKGGELLDRILAR 243


>sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma
membrane-type OS=Oryza sativa subsp. japonica
GN=Os03g0616400 PE=2 SV=1
Length = 1033

Score = 30.0 bits (66), Expect = 7.8
Identities = 13/32 (40%), Positives = 18/32 (56%)
Frame = -1

Query: 341 RIIGQPTYVGLSMYSKLKPGDCKNSQIGKAAV 246
+I+G PT L ++ L GDCK Q+G V
Sbjct: 526 QILGTPTETALLEFALLLDGDCKEKQLGSKIV 557


tr_hit_id A3BIW3
Definition tr|A3BIW3|A3BIW3_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica
Align length 36
Score (bit) 35.4
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920216|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_D07.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3BIW3|A3BIW3_ORYSJ Putative uncharacterized protein OS=Oryza... 35 2.0
tr|B7BBT5|B7BBT5_9PORP Putative uncharacterized protein OS=Parab... 34 4.5
tr|Q4P3X1|Q4P3X1_USTMA Predicted protein OS=Ustilago maydis GN=U... 33 7.7
tr|B6YS47|B6YS47_AZOPC IMP dehydrogenase OS=Azobacteroides pseud... 33 10.0
tr|Q9SE24|Q9SE24_ORYSA Calcium-dependent protein kinase OS=Oryza... 33 10.0
tr|Q8W560|Q8W560_TOBAC Calcium-dependent protein kinase CPK4 OS=... 33 10.0
tr|Q0D715|Q0D715_ORYSJ Os07g0409900 protein OS=Oryza sativa subs... 33 10.0
tr|B8Q990|B8Q990_SILDC Putative calcium dependent protein kinase... 33 10.0
tr|B8Q989|B8Q989_SILLA Putative calcium dependent protein kinase... 33 10.0
tr|B8Q988|B8Q988_SILDI Putative calcium dependent protein kinase... 33 10.0
tr|B8Q986|B8Q986_SILCU Putative calcium dependent protein kinase... 33 10.0
tr|B8Q985|B8Q985_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B8Q984|B8Q984_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B8Q983|B8Q983_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B8Q982|B8Q982_SILCO Putative calcium dependent protein kinase... 33 10.0
tr|B8Q981|B8Q981_SILGA Putative calcium dependent protein kinase... 33 10.0
tr|B8Q980|B8Q980_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B8Q979|B8Q979_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B8Q978|B8Q978_AGRGI Putative calcium dependent protein kinase... 33 10.0
tr|B8Q977|B8Q977_DIACA Putative calcium dependent protein kinase... 33 10.0
tr|B8B5E8|B8B5E8_ORYSI Putative uncharacterized protein OS=Oryza... 33 10.0
tr|B4FVF8|B4FVF8_MAIZE CDPK-related protein kinase OS=Zea mays P... 33 10.0
tr|B2LGJ4|B2LGJ4_SILLA Putative calcium dependent protein kinase... 33 10.0
tr|B2LGJ3|B2LGJ3_SILDI Putative calcium dependent protein kinase... 33 10.0
tr|B2LGJ2|B2LGJ2_SILDC Putative calcium dependent protein kinase... 33 10.0
tr|B2LGJ1|B2LGJ1_SILCU Putative calcium dependent protein kinase... 33 10.0
tr|B2LGI9|B2LGI9_SILDI Putative calcium dependent protein kinase... 33 10.0
tr|B2LGH9|B2LGH9_9CARY Putative calcium dependent protein kinase... 33 10.0
tr|B2LGH8|B2LGH8_SILCO Putative calcium dependent protein kinase... 33 10.0
tr|A9TY96|A9TY96_PHYPA Cpk19 calcium-dependent protein kinase OS... 33 10.0

>tr|A3BIW3|A3BIW3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_022985 PE=4 SV=1
Length = 540

Score = 35.4 bits (80), Expect = 2.0
Identities = 19/36 (52%), Positives = 24/36 (66%)
Frame = -2

Query: 193 QDLRLLVLYNLLTQGCIDCRLCEGGELLDRILARSD 86
+DL LL +++ RLCEGGELLDRILA+ D
Sbjct: 149 EDLTLLHVFD---------RLCEGGELLDRILAKKD 175


>tr|B7BBT5|B7BBT5_9PORP Putative uncharacterized protein
OS=Parabacteroides johnsonii DSM 18315
GN=PRABACTJOHN_02498 PE=4 SV=1
Length = 491

Score = 34.3 bits (77), Expect = 4.5
Identities = 17/50 (34%), Positives = 32/50 (64%)
Frame = -1

Query: 413 ELFSLPGLLQSNMISSLPILNLRKRIIGQPTYVGLSMYSKLKPGDCKNSQ 264
+L + +LQ + I LP+++ +KR++G TY ++ +K KP CK+S+
Sbjct: 170 DLEAAASILQQHKIEKLPVVDSQKRLVGLITYKDITR-AKDKPTACKDSK 218


>tr|Q4P3X1|Q4P3X1_USTMA Predicted protein OS=Ustilago maydis
GN=UM05192.1 PE=4 SV=1
Length = 496

Score = 33.5 bits (75), Expect = 7.7
Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
Frame = -1

Query: 443 HMKETVTFT-----WELFSLPGLLQSNMISSLPILNLRKRIIGQ---PTYVGLSMYSKLK 288
+++E +++T W L+ LPGLL +NM+ + I L RI+ Q P+ G+ +
Sbjct: 184 NLRELLSYTEFNQPWRLYMLPGLLAANMLHVIWI-GLATRIVRQLTVPSLGGIPGTNPAA 242

Query: 287 PGDCKNSQIGKAAVML*FQVFPVSV 213
PGD N+ G + ML +V PV +
Sbjct: 243 PGD--NTYSGPNSNML--EVSPVGL 263


>tr|B6YS47|B6YS47_AZOPC IMP dehydrogenase OS=Azobacteroides
pseudotrichonymphae genomovar. CFP2 GN=CFPG_756 PE=4
SV=1
Length = 491

Score = 33.1 bits (74), Expect = 10.0
Identities = 18/56 (32%), Positives = 34/56 (60%)
Frame = -1

Query: 431 TVTFTWELFSLPGLLQSNMISSLPILNLRKRIIGQPTYVGLSMYSKLKPGDCKNSQ 264
T + + +L + +LQS I LP++++ ++IG TY ++ +K KP CK+S+
Sbjct: 164 TTSQSTDLEAAADILQSYKIEKLPVVDIHNKLIGLITYKDITK-AKDKPFACKDSK 218


>tr|Q9SE24|Q9SE24_ORYSA Calcium-dependent protein kinase OS=Oryza
sativa GN=CDPK5 PE=2 SV=2
Length = 512

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 132 LCEGGELLDRILAKKD 147


>tr|Q8W560|Q8W560_TOBAC Calcium-dependent protein kinase CPK4
OS=Nicotiana tabacum PE=2 SV=1
Length = 572

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 190 LCEGGELLDRILAKKD 205


>tr|Q0D715|Q0D715_ORYSJ Os07g0409900 protein OS=Oryza sativa subsp.
japonica GN=Os07g0409900 PE=2 SV=1
Length = 512

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 132 LCEGGELLDRILAKKD 147


>tr|B8Q990|B8Q990_SILDC Putative calcium dependent protein kinase
(Fragment) OS=Silene diclinis PE=4 SV=1
Length = 197

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 36 LCEGGELLDRILAKKD 51


>tr|B8Q989|B8Q989_SILLA Putative calcium dependent protein kinase
(Fragment) OS=Silene latifolia PE=4 SV=1
Length = 197

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 36 LCEGGELLDRILAKKD 51


>tr|B8Q988|B8Q988_SILDI Putative calcium dependent protein kinase
(Fragment) OS=Silene dioica PE=4 SV=1
Length = 197

Score = 33.1 bits (74), Expect = 10.0
Identities = 14/16 (87%), Positives = 15/16 (93%)
Frame = -2

Query: 133 LCEGGELLDRILARSD 86
LCEGGELLDRILA+ D
Sbjct: 36 LCEGGELLDRILAKKD 51