BP920219
Clone id YMU001_000134_D10
Library
Length 413
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCCCACCATTAGAATAGCCTCAATATTTGACTGCATTTGTTGCTCCAACAATTCAATTA
CCTTTTCCACCTCTGGATCTAAAATCTGGTGCAAGTCTTCATGAGTGACAATAACTTATC
CATTTTCTTCTTCGGCATTGTGCCCCTCTCTTTGTCGCTGTTCAATCCACTCTTCCGCAA
GCTCCAATGGTAGATCAATCGCCTTAACTTCTAGAAATCTCCTTAACTTGAAAACCACTG
CTGCAAAGTTTTTCATGAACAACAATATCAATAGTAGCTCCCCCAACATCAACAACTGCA
AATCTGTCACCATCTCTTAGACATGTATACCTGGCCCTATGAAGGCAATGCAAAGATGCC
GCTTCAGTGCTCCAAGACTAGCCTCAAAGCATAAGGACTTACATACTCTGATT
■■Homology search results ■■ -
sp_hit_id Q8K0U4
Definition sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus
Align length 40
Score (bit) 35.4
E-value 0.09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920219|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_D10.
(413 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus muscu... 35 0.090
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapi... 35 0.090
sp|O94986|CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sap... 34 0.20
sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus muscu... 33 0.34
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapi... 32 0.76
sp|Q5B993|ATG11_EMENI Autophagy-related protein 11 OS=Emericella... 32 0.76
sp|Q9ZDW5|HSCA_RICPR Chaperone protein hscA homolog OS=Rickettsi... 31 0.95
sp|Q08224|THI20_YEAST Phosphomethylpyrimidine kinase THI20 OS=Sa... 32 1.3
sp|Q9BV73|CP250_HUMAN Centrosome-associated protein CEP250 OS=Ho... 30 3.8
sp|A8GR49|HSCA_RICRS Chaperone protein hscA homolog OS=Rickettsi... 28 4.3
sp|B0BWJ7|HSCA_RICRO Chaperone protein hscA homolog OS=Rickettsi... 28 4.3
sp|Q6PFY8|TRI45_MOUSE Tripartite motif-containing protein 45 OS=... 30 4.9
sp|A4FA70|LIPA_SACEN Lipoyl synthase OS=Saccharopolyspora erythr... 30 4.9
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology ... 29 6.5
sp|Q91ZS3|CAB45_RAT 45 kDa calcium-binding protein OS=Rattus nor... 29 6.5
sp|Q61112|CAB45_MOUSE 45 kDa calcium-binding protein OS=Mus musc... 29 6.5
sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tenta... 29 6.5
sp|Q92J07|HSCA_RICCN Chaperone protein hscA homolog OS=Rickettsi... 28 7.1
sp|Q9PL47|PMPE_CHLMU Probable outer membrane protein pmpE OS=Chl... 29 8.4
sp|Q9BRK5|CAB45_HUMAN 45 kDa calcium-binding protein OS=Homo sap... 29 8.4

>sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus
GN=Hspa12a PE=1 SV=1
Length = 675

Score = 35.4 bits (80), Expect = 0.090
Identities = 16/40 (40%), Positives = 26/40 (65%)
Frame = -1

Query: 320 LRDGDRFAVVDVGGATIDIVVHEKLCSSGFQVKEISRS*G 201
L +GD++ VVD GG T+D+ VH+ G +KE+ ++ G
Sbjct: 305 LEEGDKYVVVDSGGGTVDLTVHQIRLPEG-HLKELYKATG 343


>sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens
GN=HSPA12A PE=1 SV=2
Length = 675

Score = 35.4 bits (80), Expect = 0.090
Identities = 16/40 (40%), Positives = 26/40 (65%)
Frame = -1

Query: 320 LRDGDRFAVVDVGGATIDIVVHEKLCSSGFQVKEISRS*G 201
L +GD++ VVD GG T+D+ VH+ G +KE+ ++ G
Sbjct: 305 LEEGDKYVVVDSGGGTVDLTVHQIRLPEG-HLKELYKATG 343


>sp|O94986|CE152_HUMAN Centrosomal protein of 152 kDa OS=Homo sapiens
GN=CEP152 PE=1 SV=3
Length = 1654

Score = 34.3 bits (77), Expect = 0.20
Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)
Frame = -2

Query: 253 KNFAAVVFKLRRFLEVKAIDLPL----ELAE---EWIEQRQREGHNAEEENG*VIVTHED 95
K + L++ LE+K ++P+ ELA+ EW +++Q E H +E+N +D
Sbjct: 925 KELEEKIHSLQKELELKNEEVPVVIRAELAKARSEWNKEKQEEIHRIQEQN------EQD 978

Query: 94 LHQILDPEVEKVIELL----EQQMQSNIEAIL 11
Q LD K+ E+L E M+ E +L
Sbjct: 979 YRQFLDDHRNKINEVLAAAKEDFMKQKTELLL 1010


>sp|Q9CZJ2|HS12B_MOUSE Heat shock 70 kDa protein 12B OS=Mus musculus
GN=Hspa12b PE=1 SV=1
Length = 685

Score = 33.5 bits (75), Expect = 0.34
Identities = 11/23 (47%), Positives = 18/23 (78%)
Frame = -1

Query: 320 LRDGDRFAVVDVGGATIDIVVHE 252
+++GDR+ V D GG T+D+ VH+
Sbjct: 310 MQEGDRYMVADCGGGTVDLTVHQ 332


>sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens
GN=HSPA12B PE=1 SV=2
Length = 686

Score = 32.3 bits (72), Expect = 0.76
Identities = 11/23 (47%), Positives = 17/23 (73%)
Frame = -1

Query: 320 LRDGDRFAVVDVGGATIDIVVHE 252
++ GDR+ V D GG T+D+ VH+
Sbjct: 310 MQAGDRYVVADCGGGTVDLTVHQ 332


>sp|Q5B993|ATG11_EMENI Autophagy-related protein 11 OS=Emericella
nidulans GN=atg11 PE=3 SV=1
Length = 1371

Score = 32.3 bits (72), Expect = 0.76
Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 6/75 (8%)
Frame = -2

Query: 223 RRFLE--VKAIDLPLELAEEWIEQ----RQREGHNAEEENG*VIVTHEDLHQILDPEVEK 62
RR+LE VK + +E EE +++ R E +A+E + + +D H D E+ K
Sbjct: 633 RRYLEGEVKRFKIRVEELEEELDRLTDSRDHEKQDADERMHQLELELQDAHARADAEMRK 692

Query: 61 VIELLEQQMQSNIEA 17
LLE QMQS+ EA
Sbjct: 693 ANNLLE-QMQSHREA 706


>sp|Q9ZDW5|HSCA_RICPR Chaperone protein hscA homolog OS=Rickettsia
prowazekii GN=hscA PE=3 SV=1
Length = 593

Score = 30.8 bits (68), Expect(2) = 0.95
Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 6/71 (8%)
Frame = -2

Query: 196 DLPLELAEEWIEQRQREGHNAEEE--NG*VIVTHEDLHQILDPEVEKVI----ELLEQQM 35
DLP + + ++ +E +E N + + + L Q++ P VE+ I E LEQ
Sbjct: 246 DLPHSIETLQLAKKAKEILTYKESFNNDIISINKQTLEQLISPLVERTINITQECLEQSG 305

Query: 34 QSNIEAILMVG 2
NI+ +++VG
Sbjct: 306 NPNIDGVILVG 316



Score = 20.8 bits (42), Expect(2) = 0.95
Identities = 7/16 (43%), Positives = 12/16 (75%)
Frame = -1

Query: 287 VGGATIDIVVHEKLCS 240
+GG ID+V+ + LC+
Sbjct: 228 LGGDDIDVVITQYLCN 243


>sp|Q08224|THI20_YEAST Phosphomethylpyrimidine kinase THI20
OS=Saccharomyces cerevisiae GN=THI20 PE=1 SV=1
Length = 551

Score = 31.6 bits (70), Expect = 1.3
Identities = 16/53 (30%), Positives = 29/53 (54%)
Frame = -1

Query: 377 SWSTEAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKLCSSGFQVKE 219
++ + A +HC+ ++ CL D ++ V+ VGG ++ HEK F VK+
Sbjct: 378 AYLVDYARVHCIAGSKAPCLEDMEKELVI-VGGVRTEMGQHEKRLKEVFGVKD 429


>sp|Q9BV73|CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo
sapiens GN=CEP250 PE=1 SV=2
Length = 2442

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
Frame = -2

Query: 193 LPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQI---LDPEVEKVIELLEQQMQSNI 23
L + E I+++Q G EEE + H+ + ++ L + ++++EL E Q ++N+
Sbjct: 2065 LAQRVQENMIQEKQNLGQEREEEE--IRGLHQSVRELQLTLAQKEQEILELRETQQRNNL 2122

Query: 22 EAI 14
EA+
Sbjct: 2123 EAL 2125


>sp|A8GR49|HSCA_RICRS Chaperone protein hscA homolog OS=Rickettsia
rickettsii (strain Sheila Smith) GN=hscA PE=3 SV=1
Length = 595

Score = 28.5 bits (62), Expect(2) = 4.3
Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 6/71 (8%)
Frame = -2

Query: 196 DLPLELAEEWIEQRQREGHNAEEE--NG*VIVTHEDLHQILDPEVEKVI----ELLEQQM 35
DLP + + ++ +E ++ N V + + L Q++ P VE+ I E LEQ
Sbjct: 246 DLPNSIDTLQLAKKAKETLTYKDSFNNDNVSINKQTLEQLILPLVERTINIAQECLEQAG 305

Query: 34 QSNIEAILMVG 2
NI+ +++VG
Sbjct: 306 NPNIDGVILVG 316



Score = 20.8 bits (42), Expect(2) = 4.3
Identities = 7/16 (43%), Positives = 12/16 (75%)
Frame = -1

Query: 287 VGGATIDIVVHEKLCS 240
+GG ID+V+ + LC+
Sbjct: 228 LGGNDIDVVITQYLCN 243


tr_hit_id A9U470
Definition tr|A9U470|A9U470_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 65
Score (bit) 55.8
E-value 1.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920219|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_D10.
(413 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U470|A9U470_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|A9RFU7|A9RFU7_PHYPA Predicted protein OS=Physcomitrella paten... 49 2e-04
tr|A9S3Q3|A9S3Q3_PHYPA Predicted protein OS=Physcomitrella paten... 47 5e-04
tr|A9SZI2|A9SZI2_PHYPA Predicted protein OS=Physcomitrella paten... 46 8e-04
tr|A9S4L7|A9S4L7_PHYPA Predicted protein OS=Physcomitrella paten... 46 8e-04
tr|A9RME9|A9RME9_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.001
tr|A9RPI8|A9RPI8_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.004
tr|A9SRM9|A9SRM9_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.005
tr|A9SRN5|A9SRN5_PHYPA Predicted protein OS=Physcomitrella paten... 43 0.007
tr|B6LKX2|B6LKX2_BRAFL Putative uncharacterized protein OS=Branc... 42 0.015
tr|A9SZV1|A9SZV1_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.020
tr|Q0CZQ1|Q0CZQ1_ASPTN Putative uncharacterized protein OS=Asper... 42 0.020
tr|B6LKV2|B6LKV2_BRAFL Putative uncharacterized protein (Fragmen... 41 0.026
tr|A9S461|A9S461_PHYPA Predicted protein OS=Physcomitrella paten... 41 0.034
tr|A1CY90|A1CY90_NEOFI Putative uncharacterized protein OS=Neosa... 40 0.076
tr|Q2GU23|Q2GU23_CHAGB Putative uncharacterized protein OS=Chaet... 39 0.099
tr|A0YV32|A0YV32_9CYAN Putative chaperone protein OS=Lyngbya sp.... 39 0.13
tr|A1CVU2|A1CVU2_NEOFI Putative uncharacterized protein OS=Neosa... 39 0.13
tr|A6SSG2|A6SSG2_BOTFB Putative uncharacterized protein OS=Botry... 38 0.22
tr|A6QLJ2|A6QLJ2_BOVIN HSPA12B protein OS=Bos taurus GN=HSPA12B ... 38 0.29
tr|B8MPG3|B8MPG3_9EURO Hsp70 family chaperone, putative OS=Talar... 38 0.29
tr|B0D7P7|B0D7P7_LACBS Predicted protein OS=Laccaria bicolor (st... 38 0.29
tr|B6QDP3|B6QDP3_PENMA Hsp70 family protein OS=Penicillium marne... 37 0.38
tr|Q0UK62|Q0UK62_PHANO Putative uncharacterized protein OS=Phaeo... 37 0.49
tr|Q4T1U4|Q4T1U4_TETNG Chromosome undetermined SCAF10478, whole ... 37 0.64
tr|Q0P408|Q0P408_DANRE Zgc:153612 OS=Danio rerio GN=zgc:153612 P... 37 0.64
tr|B6GW36|B6GW36_PENCH Pc06g00970 protein OS=Penicillium chrysog... 36 0.84
tr|A7EYH2|A7EYH2_SCLS1 Putative uncharacterized protein OS=Scler... 36 0.84
tr|A2QXA7|A2QXA7_ASPNC Similarity to Neisseria meningitidis Hsp7... 36 0.84
tr|Q5BF14|Q5BF14_EMENI Putative uncharacterized protein OS=Emeri... 36 1.1

>tr|A9U470|A9U470_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_101722 PE=4 SV=1
Length = 581

Score = 55.8 bits (133), Expect = 1e-06
Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKLCSSG-FQVKEISRS*GD*ST 189
EAA+++CL + R L GD+F V D+GG T DIVV EK SSG +VKE++ S G
Sbjct: 208 EAAAVYCLKKLRNFKLNQGDKFLVADIGGGTSDIVVQEKANSSGSLKVKEVTASSG---- 263

Query: 188 IGACG 174
G CG
Sbjct: 264 -GLCG 267


>tr|A9RFU7|A9RFU7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_65569 PE=4 SV=1
Length = 828

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKL-CSSGFQVKEISRS*GD*ST 189
EAAS HC R L GDR V D+GG T D+V+ + L + ++V+E++RS G
Sbjct: 451 EAASYHCYKYLRNGVLNTGDRVLVADIGGGTADLVMQKALDVGANYRVEEVTRSSG---- 506

Query: 188 IGACGRV 168
G CG +
Sbjct: 507 -GLCGGI 512



Score = 44.7 bits (104), Expect = 0.002
Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 3/69 (4%)
Frame = -2

Query: 199 IDLPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQILDPEVEKVIELLE---QQMQS 29
+DLP +LA++W + G +E+ G V+++ DL QI P VE+ + L+ Q+++
Sbjct: 564 LDLPRQLADQWEKYDMEMGFERKEDYGEVVISDIDLEQIFRPVVERNLSLIAAQLDQVKA 623

Query: 28 NIEAILMVG 2
++ +L+VG
Sbjct: 624 PVKVLLVVG 632


>tr|A9S3Q3|A9S3Q3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_74166 PE=4 SV=1
Length = 650

Score = 47.0 bits (110), Expect = 5e-04
Identities = 22/68 (32%), Positives = 42/68 (61%), Gaps = 2/68 (2%)
Frame = -2

Query: 199 IDLPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQILDPEVEKVIELLEQQMQ--SN 26
IDL L ++W E R+G+ A E + +T +DL I DP V++++E++ Q++ S+
Sbjct: 385 IDLHSRLRDKWKEHETRQGYPARESYSEIELTEKDLKSIFDPVVDEILEMIAAQLRLVSD 444

Query: 25 IEAILMVG 2
++ + +VG
Sbjct: 445 VKVMFVVG 452



Score = 39.7 bits (91), Expect = 0.076
Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 6/61 (9%)
Frame = -1

Query: 365 EAASLHCLHRARYT----CLRDGDRFAVVDVGGATIDIVVHEKLCSS--GFQVKEISRS* 204
EAAS HC R + L D+ VVD GG T+DIVV L S F+V+E++ S
Sbjct: 263 EAASFHCHQMLRQSHANVILEPMDKMLVVDAGGGTVDIVVQRLLSRSFERFKVEEVTPST 322

Query: 203 G 201
G
Sbjct: 323 G 323


>tr|A9SZI2|A9SZI2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167293 PE=4 SV=1
Length = 844

Score = 46.2 bits (108), Expect = 8e-04
Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 2/68 (2%)
Frame = -2

Query: 199 IDLPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQILDPEVEKVIELLEQQMQ--SN 26
I L LAE+W + +R G+ + + +T +D+ I DP V+++I+L+ Q++ +N
Sbjct: 559 ISLHRNLAEKWEDYERRRGYPPRKSYSEIKLTQQDMMSIFDPVVDEIIKLIAAQLEKVTN 618

Query: 25 IEAILMVG 2
I+AI +VG
Sbjct: 619 IKAIFVVG 626



Score = 39.7 bits (91), Expect = 0.076
Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 5/69 (7%)
Frame = -1

Query: 365 EAASLHC--LHRARY--TCLRDGDRFAVVDVGGATIDIVVHE-KLCSSGFQVKEISRS*G 201
EAAS HC L +Y CL D V D+GG T+DIVV + K ++V+E++ S G
Sbjct: 439 EAASFHCHQLMPKQYPKVCLDRCDNILVADIGGGTVDIVVQKLKGIGRDYKVEELTESSG 498

Query: 200 D*STIGACG 174
G CG
Sbjct: 499 -----GLCG 502


>tr|A9S4L7|A9S4L7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162811 PE=4 SV=1
Length = 605

Score = 46.2 bits (108), Expect = 8e-04
Identities = 28/65 (43%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKL-CSSGFQVKEISRS*GD*ST 189
EAAS HC L GD+ V D+GG T DIVV E + S ++VKE++ S G
Sbjct: 211 EAASFHCHKVMSQEFLEVGDKLLVADIGGGTSDIVVQEVISVGSNYRVKEVTTSSG---- 266

Query: 188 IGACG 174
G CG
Sbjct: 267 -GLCG 270


>tr|A9RME9|A9RME9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_159966 PE=4 SV=1
Length = 1274

Score = 44.7 bits (104), Expect(2) = 0.001
Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKL-CSSGFQVKEISRS*GD*ST 189
EAAS HC + L GD+ V D+GG T DIVV E + ++VKE++ S G
Sbjct: 204 EAASFHCYKVMKEQILEVGDKILVADIGGGTSDIVVQEVVSVGECYRVKELTTSSG---- 259

Query: 188 IGACG 174
G CG
Sbjct: 260 -GLCG 263



Score = 20.8 bits (42), Expect(2) = 0.001
Identities = 7/20 (35%), Positives = 12/20 (60%)
Frame = -3

Query: 198 LIYHWSLRKSGLNSDKERGT 139
LI +W ++K+G +E T
Sbjct: 297 LIKNWEVKKTGFGLSRESST 316



Score = 41.2 bits (95), Expect = 0.026
Identities = 19/56 (33%), Positives = 34/56 (60%)
Frame = -2

Query: 199 IDLPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQILDPEVEKVIELLEQQMQ 32
I LP L +EW +REG A E + +++E++ I DP VE+++ L+ +Q++
Sbjct: 1008 ISLPKILLKEWERYDKREGKFARESYDELEISYEEMQSIFDPVVEQLVGLIAEQLE 1063


>tr|A9RPI8|A9RPI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_160266 PE=4 SV=1
Length = 801

Score = 43.9 bits (102), Expect = 0.004
Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKLC--SSGFQVKEISRS*GD*S 192
EAA HC + + D+ + D+GG T DIVV + + S +QVKE++ S G
Sbjct: 419 EAAFFHCYQHLHESAITVNDKILIADIGGGTSDIVVEQVVAIGQSSYQVKEVTFSSG--- 475

Query: 191 TIGACGRV 168
G CG +
Sbjct: 476 --GLCGSI 481


>tr|A9SRM9|A9SRM9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233870 PE=4 SV=1
Length = 937

Score = 43.5 bits (101), Expect = 0.005
Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKLC--SSGFQVKEISRS*GD*S 192
EAAS HC L GD+ V D+GG T D++V E + G++VKE++ S G
Sbjct: 367 EAASFHCHKVMNEQVLSVGDKLLVADIGGGTSDLIVQEVISVGERGYRVKELTISSG--- 423

Query: 191 TIGACG 174
G CG
Sbjct: 424 --GYCG 427


>tr|A9SRN5|A9SRN5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233874 PE=4 SV=1
Length = 592

Score = 43.1 bits (100), Expect = 0.007
Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
Frame = -1

Query: 365 EAASLHCLHRARYTCLRDGDRFAVVDVGGATIDIVVHEKLCS--SGFQVKEISRS*GD*S 192
EAAS +C L+ GDR V D+GG T DIVV E + + ++VKE++ S G
Sbjct: 208 EAASCYCHRNMPDLELKAGDRLLVADIGGGTTDIVVQEWMSETPNDYRVKEVTYSTG--- 264

Query: 191 TIGACG 174
G CG
Sbjct: 265 --GLCG 268



Score = 39.7 bits (91), Expect = 0.076
Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
Frame = -2

Query: 199 IDLPLELAEEWIEQRQREGHNAEEENG*VIVTHEDLHQILDPEVEKVIELLEQQMQ--SN 26
I LP +LA+EW + G + + +T D+ I DP VE+ + L+ Q+ SN
Sbjct: 324 IQLPGKLAQEWEDYDSEHGLPPRDSYDELELTQSDMQSIFDPVVEQNLGLIADQLSRTSN 383

Query: 25 IEAILMVG 2
++ I +VG
Sbjct: 384 VKVIFVVG 391


>tr|B6LKX2|B6LKX2_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_208293 PE=4 SV=1
Length = 582

Score = 42.0 bits (97), Expect = 0.015
Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)
Frame = -1

Query: 365 EAASLHCLH---RARYTCLRDGDRFAVVDVGGATIDIVVHE 252
EAA + C H + + L+ GDR+ +VD GG T+DI VHE
Sbjct: 191 EAAGIFCRHDLTKKKLVNLKPGDRYMIVDCGGGTVDITVHE 231