BP920226
Clone id YMU001_000134_E05
Library
Length 532
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGTCGCCCTATCATTCTGGCTGGCAACGAAGATACCGTTACAAGAGCAGTTCAACGCG
CTGAGAGGTTTCGTACCGATATTGCTCAAGCGAGGAGTTTTGCTGGTGCCTTTAATATGG
AGCGATACAAAAGAAGAGTTGTCTGGAAAGAAGACAAAAGTGTTTCGGGAACCAAGGCCC
TGTTGTGCCTGCAACTACAGTAGCTGCGGATGATTTTGAAGCACGTGCTAAAGAAATTTC
ATCTAAGACTGTGGAGAAAGCAGACAGGAAACTCAAGGCAGAAGTGGTTTCTCCTCCGGA
GTGGGACAGATGGGTTCGAGAACAACAAGAGGTAGAAGGTGTTGAGCCAGGATCAGAGGT
CTATATTGTTTTGCGCTTAGATGGCCGCGTGCGAAAATCTGGAAAGGGCATGCCTGATTG
GGAGGAGCTTGTAAAGGACCTTCCTGATTTAGATACTTTGGTGAGCAAACTTGAAAAATG
AAGTCATTGAAGCAGCATTGGCATAGGCGTCAGGAGTTGGCAGACTCTTATG
■■Homology search results ■■ -
sp_hit_id Q97P31
Definition sp|Q97P31|TRPF_STRPN N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus pneumoniae
Align length 60
Score (bit) 30.8
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920226|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_E05.
(532 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q97P31|TRPF_STRPN N-(5'-phosphoribosyl)anthranilate isomerase... 31 4.2
sp|Q73Q47|Y597_TREDE Putative reductase TDE_0597 OS=Treponema de... 31 4.3
sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator... 30 5.5
sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculu... 30 5.6
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorh... 30 5.6
sp|Q24524|SING_DROME Protein singed OS=Drosophila melanogaster G... 30 7.2
sp|Q9C5V6|TOP6B_ARATH DNA topoisomerase 6 subunit B OS=Arabidops... 30 7.3
sp|Q2HBI0|TOF1_CHAGB Topoisomerase 1-associated factor 1 OS=Chae... 30 7.3
sp|Q8PC75|RBN_XANCP tRNA-processing ribonuclease BN OS=Xanthomon... 30 7.3
sp|Q4URA9|RBN_XANC8 tRNA-processing ribonuclease BN OS=Xanthomon... 30 7.3
sp|A5V592|SYV_SPHWW Valyl-tRNA synthetase OS=Sphingomonas wittic... 30 9.5
sp|Q3BX14|RBN_XANC5 tRNA-processing ribonuclease BN OS=Xanthomon... 30 9.5
sp|Q076A3|MYH13_CANFA Myosin-13 OS=Canis familiaris GN=MYH13 PE=... 30 9.5

>sp|Q97P31|TRPF_STRPN N-(5'-phosphoribosyl)anthranilate isomerase
OS=Streptococcus pneumoniae GN=trpF PE=3 SV=1
Length = 199

Score = 30.8 bits (68), Expect = 4.2
Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Frame = +3

Query: 3 SRPIILAG--NEDTVTRAVQRAERFRTDIAQARSFAGAFNMERYKRRVVWKEDKSVSGTK 176
++P +AG NED V +A+Q + D++ G + E+ RR + + +SGTK
Sbjct: 141 AQPFFIAGGLNEDNVVKAIQHFTPYAVDVSSGVETDGQKDHEKI-RRFIERVKHGISGTK 199


>sp|Q73Q47|Y597_TREDE Putative reductase TDE_0597 OS=Treponema
denticola GN=TDE_0597 PE=3 SV=1
Length = 397

Score = 30.8 bits (68), Expect = 4.3
Identities = 13/53 (24%), Positives = 25/53 (47%)
Frame = +2

Query: 194 TTVAADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVEPG 352
T D F KEIS++ + +V+ +W+RW+++ + +E G
Sbjct: 170 TGKTVDPFTGELKEISAEPANDEEAAATVKVMGGEDWERWIKQLSKEGLLEEG 222


>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2
OS=Arabidopsis thaliana GN=CMTA2 PE=2 SV=1
Length = 1050

Score = 30.4 bits (67), Expect = 5.5
Identities = 18/58 (31%), Positives = 24/58 (41%), Gaps = 21/58 (36%)
Frame = -3

Query: 401 QIFARGHLSAKQYRPLILAQHLLPLVVL---------------------EPICPTPEE 291
Q RGH KQYR +I + LL ++L EP+CP P+E
Sbjct: 901 QAHVRGHQVRKQYRAIIWSVGLLEKIILRWRRKGSGLRGFKRDTISKPTEPVCPAPQE 958


>sp|P04461|MYH7_RABIT Myosin-7 (Fragment) OS=Oryctolagus cuniculus
GN=MYH7 PE=2 SV=1
Length = 736

Score = 30.4 bits (67), Expect = 5.6
Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 18/113 (15%)
Frame = +2

Query: 203 AADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVEPGSEVYIVLRLD 382
A + EAR KE+ KTV K ++ E D ++ + + + ++L+
Sbjct: 426 ALEKSEARRKELEEKTVSLLQEKNDLQLQVQAEQDNLADAEERCDQL-----IKNKIQLE 480

Query: 383 GRVRKSGKGMPDWE------------------ELVKDLPDLDTLVSKLEK*SH 487
+V++ + + D E EL +D+ DL+ ++K+EK H
Sbjct: 481 AKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKH 533


>sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2
OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1
Length = 974

Score = 30.4 bits (67), Expect = 5.6
Identities = 17/47 (36%), Positives = 22/47 (46%)
Frame = +1

Query: 166 REPRPCCACNYSSCG*F*STC*RNFI*DCGESRQETQGRSGFSSGVG 306
REPR C C + DC E R+ +GR+GF+SG G
Sbjct: 393 REPRVCYNCQQPG----------HNSRDCPEERKPREGRNGFTSGFG 429


>sp|Q24524|SING_DROME Protein singed OS=Drosophila melanogaster
GN=sn PE=2 SV=1
Length = 512

Score = 30.0 bits (66), Expect = 7.2
Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
Frame = -3

Query: 482 FIFQVCSPKYLNQEGPLQAPPNQACPFQI-FARGHLSAKQYRPLILAQHLLPL 327
+ C+ KYLN G LQ N+ C F + GHL+ + + Q+L P+
Sbjct: 201 YALHTCNNKYLNANGKLQVVCNEDCLFSAEYHGGHLALRDRQ----GQYLSPI 249


>sp|Q9C5V6|TOP6B_ARATH DNA topoisomerase 6 subunit B OS=Arabidopsis
thaliana GN=TOP6B PE=1 SV=1
Length = 670

Score = 30.0 bits (66), Expect = 7.3
Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
Frame = +2

Query: 200 VAADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVE-PGSEVYIVLR 376
+A DD K S + + + KLK + SP E+ E + + G + PG +Y
Sbjct: 1 MAGDDLVETKKGSSKNSKDSNESKLKQK--SPAEF---FAENKNIAGFDNPGKSLYTT-- 53

Query: 377 LDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLEK*SH*SSIGI 505
VR+ + D E + +LP+++ + ++ K S IG+
Sbjct: 54 ----VRELVENALDSAESISELPEVEVTIEEIVKSKFNSMIGL 92


>sp|Q2HBI0|TOF1_CHAGB Topoisomerase 1-associated factor 1
OS=Chaetomium globosum GN=TOF1 PE=3 SV=1
Length = 1251

Score = 30.0 bits (66), Expect = 7.3
Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 11/111 (9%)
Frame = +2

Query: 134 KSCLERRQKCFGNQGPVVPATTVAAD-DFEARAKEISSKTVEKADRKLKAEVVSPPEWDR 310
K L+RR++ G+ P A T D EARA+ K +EKA RK+K+E+ P D
Sbjct: 959 KKRLQRRRRRGGSDDP--DADTAETDAQAEARARARRKKELEKA-RKIKSEMYVDPRED- 1014

Query: 311 WVREQQEVEGVEPGSEVYIVLRLDGRV----------RKSGKGMPDWEELV 433
+ EG + ++ + + R G G WE LV
Sbjct: 1015 ----DSDYEGNKERDRLFFAREEERQAVKDATFGLSSRPEGVGEGAWEALV 1061


>sp|Q8PC75|RBN_XANCP tRNA-processing ribonuclease BN OS=Xanthomonas
campestris pv. campestris GN=rbn PE=3 SV=1
Length = 425

Score = 30.0 bits (66), Expect = 7.3
Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
Frame = +2

Query: 317 REQQEVEGVEPGSEVYIVLRLDGRVRKS---GKGMPDWEELVKDLPDLDTLVSKL 472
R Q E + PG E+Y +LRL GR R++ G G+ + L + DTL+ +L
Sbjct: 282 RYQPEAMRLPPGFEIYGLLRLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQEL 336


>sp|Q4URA9|RBN_XANC8 tRNA-processing ribonuclease BN OS=Xanthomonas
campestris pv. campestris (strain 8004) GN=rbn PE=3 SV=1
Length = 425

Score = 30.0 bits (66), Expect = 7.3
Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
Frame = +2

Query: 317 REQQEVEGVEPGSEVYIVLRLDGRVRKS---GKGMPDWEELVKDLPDLDTLVSKL 472
R Q E + PG E+Y +LRL GR R++ G G+ + L + DTL+ +L
Sbjct: 282 RYQPEAMRLPPGFEIYGLLRLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQEL 336


tr_hit_id A7Q095
Definition tr|A7Q095|A7Q095_VITVI Chromosome chr7 scaffold_42, whole genome shotgun sequence OS=Vitis vinifera
Align length 111
Score (bit) 129.0
E-value 8.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920226|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_E05.
(532 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q095|A7Q095_VITVI Chromosome chr7 scaffold_42, whole genome... 129 8e-38
tr|A5BYD7|A5BYD7_VITVI Putative uncharacterized protein OS=Vitis... 129 2e-37
tr|Q9SRY4|Q9SRY4_ARATH F22D16.9 protein OS=Arabidopsis thaliana ... 120 9e-35
tr|Q5ZBW3|Q5ZBW3_ORYSJ cDNA clone:001-009-G10, full insert seque... 124 2e-33
tr|B8A7X3|B8A7X3_ORYSI Putative uncharacterized protein OS=Oryza... 124 2e-33
tr|A6N009|A6N009_ORYSI Tpr domain containing protein (Fragment) ... 124 2e-33
tr|B4G0A6|B4G0A6_MAIZE Putative uncharacterized protein OS=Zea m... 112 1e-31
tr|A9SDQ5|A9SDQ5_PHYPA Predicted protein OS=Physcomitrella paten... 117 4e-31
tr|A2ZT15|A2ZT15_ORYSJ Putative uncharacterized protein OS=Oryza... 108 2e-22
tr|A7Q1G1|A7Q1G1_VITVI Chromosome chr7 scaffold_44, whole genome... 64 3e-10
tr|B8ARR1|B8ARR1_ORYSI Putative uncharacterized protein OS=Oryza... 62 1e-09
tr|Q7X6M7|Q7X6M7_ORYSJ cDNA clone:001-041-H09, full insert seque... 62 1e-09
tr|Q7F951|Q7F951_ORYSA OSJNBb0002J11.14 protein (OSIGBa0157A06.4... 62 1e-09
tr|Q9SVU2|Q9SVU2_ARATH Putative uncharacterized protein F16A16.1... 65 3e-09
tr|Q94AF3|Q94AF3_ARATH AT4g28740/F16A16_150 OS=Arabidopsis thali... 65 3e-09
tr|A8IBH6|A8IBH6_CHLRE Predicted protein OS=Chlamydomonas reinha... 64 6e-09
tr|A1YSB4|A1YSB4_CHLRE Photosystem-II repair protein OS=Chlamydo... 64 6e-09
tr|A9S8E7|A9S8E7_PHYPA Predicted protein (Fragment) OS=Physcomit... 63 8e-09
tr|B4FCK8|B4FCK8_MAIZE Putative uncharacterized protein OS=Zea m... 58 3e-07
tr|A4S8N6|A4S8N6_OSTLU Predicted protein OS=Ostreococcus lucimar... 52 3e-07
tr|A4S4X1|A4S4X1_OSTLU Predicted protein (Fragment) OS=Ostreococ... 57 8e-07
tr|Q00YR0|Q00YR0_OSTTA Homology to unknown gene OS=Ostreococcus ... 56 1e-06
tr|Q00TX4|Q00TX4_OSTTA Homology to unknown gene OS=Ostreococcus ... 54 4e-06
tr|A8HWL8|A8HWL8_CHLRE Predicted protein OS=Chlamydomonas reinha... 50 7e-05
tr|Q0DDB7|Q0DDB7_ORYSJ Os06g0235500 protein (Fragment) OS=Oryza ... 40 0.057
tr|B8B4F1|B8B4F1_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.057
tr|A3BA13|A3BA13_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.13
tr|A9SE14|A9SE14_PHYPA Predicted protein OS=Physcomitrella paten... 39 0.17
tr|Q4C179|Q4C179_CROWT Abortive infection protein OS=Crocosphaer... 39 0.22
tr|B0T7M7|B0T7M7_CAUSK ABC transporter related OS=Caulobacter sp... 35 1.8

>tr|A7Q095|A7Q095_VITVI Chromosome chr7 scaffold_42, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027965001
PE=4 SV=1
Length = 436

Score = 129 bits (325), Expect(3) = 8e-38
Identities = 58/111 (52%), Positives = 83/111 (74%)
Frame = +2

Query: 146 ERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQ 325
+ +K FG + +DFE R + I++K+ KA+ + KAEVVSP EW+RW+R+Q
Sbjct: 326 QMEKKGFGIPSKAATSLPSIGEDFEKRTESIAAKSRLKAEVRFKAEVVSPAEWERWIRDQ 385

Query: 326 QEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLEK 478
Q+ EGV PG +VYI+LRLDGRVR+SGKGMPDW+++VK+LP ++ L+SKLE+
Sbjct: 386 QKSEGVTPGEDVYIILRLDGRVRRSGKGMPDWQQIVKELPPMEALLSKLER 436



Score = 38.5 bits (88), Expect(3) = 8e-38
Identities = 15/26 (57%), Positives = 24/26 (92%)
Frame = +3

Query: 6 RPIILAGNEDTVTRAVQRAERFRTDI 83
RP+ILAG ++TV+ A+++AERFRT++
Sbjct: 282 RPVILAGTKETVSLAIKKAERFRTEL 307



Score = 32.7 bits (73), Expect(3) = 8e-38
Identities = 15/24 (62%), Positives = 17/24 (70%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEELSGKK 153
LLKRGVLLVP+IW + K KK
Sbjct: 307 LLKRGVLLVPVIWGENKAPQMEKK 330


>tr|A5BYD7|A5BYD7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033366 PE=4 SV=1
Length = 467

Score = 129 bits (325), Expect(3) = 2e-37
Identities = 58/111 (52%), Positives = 83/111 (74%)
Frame = +2

Query: 146 ERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQ 325
+ +K FG + +DFE R + I++K+ KA+ + KAEVVSP EW+RW+R+Q
Sbjct: 357 QMEKKGFGIPSKAATSLPSIGEDFEKRTESIAAKSRLKAEVRFKAEVVSPAEWERWIRDQ 416

Query: 326 QEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLEK 478
Q+ EGV PG +VYI+LRLDGRVR+SGKGMPDW+++VK+LP ++ L+SKLE+
Sbjct: 417 QKSEGVTPGEDVYIILRLDGRVRRSGKGMPDWQQIVKELPPMEALLSKLER 467



Score = 37.4 bits (85), Expect(3) = 2e-37
Identities = 15/26 (57%), Positives = 23/26 (88%)
Frame = +3

Query: 6 RPIILAGNEDTVTRAVQRAERFRTDI 83
RP+ILAG ++TV+ A++ AERFRT++
Sbjct: 313 RPVILAGTKETVSLAIKXAERFRTEL 338



Score = 32.7 bits (73), Expect(3) = 2e-37
Identities = 15/24 (62%), Positives = 17/24 (70%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEELSGKK 153
LLKRGVLLVP+IW + K KK
Sbjct: 338 LLKRGVLLVPVIWGENKAPQMEKK 361


>tr|Q9SRY4|Q9SRY4_ARATH F22D16.9 protein OS=Arabidopsis thaliana
GN=At1g02910 PE=4 SV=1
Length = 453

Score = 120 bits (302), Expect(3) = 9e-35
Identities = 54/111 (48%), Positives = 78/111 (70%)
Frame = +2

Query: 146 ERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQ 325
E +K FG + +DF+ RA+ + +++ K + + KAE VSP EW+RW+R+Q
Sbjct: 343 EIEKKGFGASSKAATSLPSIGEDFDTRAQSVVAQSKLKGEIRFKAETVSPGEWERWIRDQ 402

Query: 326 QEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLEK 478
Q EGV PG +VYI+LRLDGRVR+SG+GMPDW E+ K+LP +D ++SKLE+
Sbjct: 403 QISEGVNPGDDVYIILRLDGRVRRSGRGMPDWAEISKELPPMDDVLSKLER 453



Score = 39.7 bits (91), Expect(3) = 9e-35
Identities = 16/26 (61%), Positives = 24/26 (92%)
Frame = +3

Query: 6 RPIILAGNEDTVTRAVQRAERFRTDI 83
RP+ILAG ++TVT A+Q+A+RFRT++
Sbjct: 299 RPVILAGKKETVTLAMQKADRFRTEL 324



Score = 30.0 bits (66), Expect(3) = 9e-35
Identities = 13/24 (54%), Positives = 17/24 (70%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEELSGKK 153
LL+RGVLLVP++W + K KK
Sbjct: 324 LLRRGVLLVPVVWGERKTPEIEKK 347


>tr|Q5ZBW3|Q5ZBW3_ORYSJ cDNA clone:001-009-G10, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0514H03.13 PE=2 SV=1
Length = 455

Score = 124 bits (312), Expect(2) = 2e-33
Identities = 58/121 (47%), Positives = 89/121 (73%)
Frame = +2

Query: 116 YGAIQKKSCLERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSP 295
+GA QK + + + FG+ A +V DDFE R + I++K+ KA+ + KA++VSP
Sbjct: 339 FGASQKA---QSKPRGFGSSRSAASAPSVG-DDFEKRTESIAAKSRLKAEERFKADIVSP 394

Query: 296 PEWDRWVREQQEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLE 475
+W+ W+R+QQE EGV PG +VYI+LRLDGRVR+SG+GMP+W +++++LP L+ L+SKLE
Sbjct: 395 EQWESWIRDQQESEGVTPGEDVYIILRLDGRVRRSGRGMPNWNDILQELPRLEELLSKLE 454

Query: 476 K 478
+
Sbjct: 455 R 455



Score = 40.8 bits (94), Expect(2) = 2e-33
Identities = 16/27 (59%), Positives = 26/27 (96%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+ILAG++ ++TRA+QRAER+RT++
Sbjct: 301 TRPVILAGSKASITRAMQRAERYRTEL 327


>tr|B8A7X3|B8A7X3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01883 PE=4 SV=1
Length = 455

Score = 124 bits (312), Expect(2) = 2e-33
Identities = 58/121 (47%), Positives = 89/121 (73%)
Frame = +2

Query: 116 YGAIQKKSCLERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSP 295
+GA QK + + + FG+ A +V DDFE R + I++K+ KA+ + KA++VSP
Sbjct: 339 FGASQKA---QSKPRGFGSSRSAASAPSVG-DDFEKRTESIAAKSRLKAEERFKADIVSP 394

Query: 296 PEWDRWVREQQEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLE 475
+W+ W+R+QQE EGV PG +VYI+LRLDGRVR+SG+GMP+W +++++LP L+ L+SKLE
Sbjct: 395 EQWESWIRDQQESEGVTPGEDVYIILRLDGRVRRSGRGMPNWNDILQELPRLEELLSKLE 454

Query: 476 K 478
+
Sbjct: 455 R 455



Score = 40.8 bits (94), Expect(2) = 2e-33
Identities = 16/27 (59%), Positives = 26/27 (96%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+ILAG++ ++TRA+QRAER+RT++
Sbjct: 301 TRPVILAGSKASITRAMQRAERYRTEL 327


>tr|A6N009|A6N009_ORYSI Tpr domain containing protein (Fragment)
OS=Oryza sativa subsp. indica PE=2 SV=1
Length = 192

Score = 124 bits (312), Expect(2) = 2e-33
Identities = 58/121 (47%), Positives = 89/121 (73%)
Frame = +2

Query: 116 YGAIQKKSCLERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSP 295
+GA QK + + + FG+ A +V DDFE R + I++K+ KA+ + KA++VSP
Sbjct: 76 FGASQKA---QSKPRGFGSSRSAASAPSVG-DDFEKRTESIAAKSRLKAEERFKADIVSP 131

Query: 296 PEWDRWVREQQEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLE 475
+W+ W+R+QQE EGV PG +VYI+LRLDGRVR+SG+GMP+W +++++LP L+ L+SKLE
Sbjct: 132 EQWESWIRDQQESEGVTPGEDVYIILRLDGRVRRSGRGMPNWNDILQELPRLEELLSKLE 191

Query: 476 K 478
+
Sbjct: 192 R 192



Score = 40.8 bits (94), Expect(2) = 2e-33
Identities = 16/27 (59%), Positives = 26/27 (96%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+ILAG++ ++TRA+QRAER+RT++
Sbjct: 38 TRPVILAGSKASITRAMQRAERYRTEL 64


>tr|B4G0A6|B4G0A6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 450

Score = 112 bits (281), Expect(3) = 1e-31
Identities = 54/121 (44%), Positives = 84/121 (69%)
Frame = +2

Query: 116 YGAIQKKSCLERRQKCFGNQGPVVPATTVAADDFEARAKEISSKTVEKADRKLKAEVVSP 295
+GA QK + + + FG + +V D FE R + I++K+ K + + KA++VSP
Sbjct: 334 FGASQKD---QTKPRGFGARRAAASVPSVGGD-FEKRTESIAAKSRLKTEVRFKADIVSP 389

Query: 296 PEWDRWVREQQEVEGVEPGSEVYIVLRLDGRVRKSGKGMPDWEELVKDLPDLDTLVSKLE 475
+W+ W+R+QQ EGV PG +VYI+LRLDGRVR+SG GMP+W +++++LP L+ L+SKLE
Sbjct: 390 EQWESWIRDQQVSEGVTPGEDVYIILRLDGRVRRSGIGMPNWNDILQELPRLEDLMSKLE 449

Query: 476 K 478
+
Sbjct: 450 R 450



Score = 41.2 bits (95), Expect(3) = 1e-31
Identities = 17/27 (62%), Positives = 26/27 (96%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+ILAG++ +VTRA+QRAER+RT++
Sbjct: 296 TRPVILAGSKASVTRALQRAERYRTEL 322



Score = 25.8 bits (55), Expect(3) = 1e-31
Identities = 10/19 (52%), Positives = 17/19 (89%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEE 138
LLKRGVLL+P+I+ ++++
Sbjct: 322 LLKRGVLLIPVIFGASQKD 340


>tr|A9SDQ5|A9SDQ5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_164395 PE=4 SV=1
Length = 458

Score = 117 bits (294), Expect(3) = 4e-31
Identities = 52/90 (57%), Positives = 71/90 (78%)
Frame = +2

Query: 209 DDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVEPGSEVYIVLRLDGR 388
D+FE R + ++K V + +++ KAE VSP EW+ WVREQQE EGV PG +V++VLRLDGR
Sbjct: 369 DEFEQRIQAAAAKGVIQGEKRFKAEPVSPVEWESWVREQQESEGVTPGEDVFVVLRLDGR 428

Query: 389 VRKSGKGMPDWEELVKDLPDLDTLVSKLEK 478
+RKSG+GMP+W ++V +L LDT +SKLEK
Sbjct: 429 IRKSGRGMPEWVDIVNELAPLDTFISKLEK 458



Score = 30.8 bits (68), Expect(3) = 4e-31
Identities = 13/24 (54%), Positives = 16/24 (66%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEELSGKK 153
LLKRGVL++PL+WS KK
Sbjct: 336 LLKRGVLIIPLVWSKNNPTKPKKK 359



Score = 29.6 bits (65), Expect(3) = 4e-31
Identities = 9/27 (33%), Positives = 21/27 (77%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+I+AG + V R+++ ++++R D+
Sbjct: 310 TRPVIIAGTAENVERSIRASQKYREDL 336


>tr|A2ZT15|A2ZT15_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_001687 PE=4 SV=1
Length = 433

Score = 108 bits (269), Expect = 2e-22
Identities = 44/84 (52%), Positives = 70/84 (83%)
Frame = +2

Query: 227 AKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVEPGSEVYIVLRLDGRVRKSGK 406
+++ +K+ KA+ + KA++VSP +W+ W+R+QQE EGV PG +VYI+LRLDGRVR+SG+
Sbjct: 350 SQKAQTKSRLKAEERFKADIVSPEQWESWIRDQQESEGVTPGEDVYIILRLDGRVRRSGR 409

Query: 407 GMPDWEELVKDLPDLDTLVSKLEK 478
GMP+W +++++LP L+ L+SKLE+
Sbjct: 410 GMPNWNDILQELPRLEELLSKLER 433



Score = 40.8 bits (94), Expect(2) = 4e-04
Identities = 16/27 (59%), Positives = 26/27 (96%)
Frame = +3

Query: 3 SRPIILAGNEDTVTRAVQRAERFRTDI 83
+RP+ILAG++ ++TRA+QRAER+RT++
Sbjct: 309 TRPVILAGSKASITRAMQRAERYRTEL 335



Score = 25.8 bits (55), Expect(2) = 4e-04
Identities = 11/26 (42%), Positives = 19/26 (73%)
Frame = +1

Query: 82 LLKRGVLLVPLIWSDTKEELSGKKTK 159
LLKRGVLL+P+I+ +++ + + K
Sbjct: 335 LLKRGVLLIPVIFGASQKAQTKSRLK 360


>tr|A7Q1G1|A7Q1G1_VITVI Chromosome chr7 scaffold_44, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028450001
PE=4 SV=1
Length = 237

Score = 63.9 bits (154), Expect(2) = 3e-10
Identities = 36/91 (39%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
Frame = +2

Query: 182 VVPATTVAA-DDFEARAKEISSKTVEKADRKLKAEVVSPPEWDRWVREQQEVEGVEPGSE 358
VVP T FE E K R + V EW +W+ EQ+++ GV P S
Sbjct: 131 VVPFVTDGKLPSFEYEESEEMKDITTKRKRLWQLVPVYVSEWSKWLDEQKKLAGVSPESP 190

Query: 359 VYIVLRLDGRVRKSGKGMPDWEELVKDLPDL 451
VY+ LR+DGRVR SG G P W V LP +
Sbjct: 191 VYLSLRMDGRVRGSGVGYPPWNAFVAQLPPI 221



Score = 23.9 bits (50), Expect(2) = 3e-10
Identities = 11/26 (42%), Positives = 15/26 (57%)
Frame = +1

Query: 40 LQEQFNALRGFVPILLKRGVLLVPLI 117
+ E F + F LL RGVL+VP +
Sbjct: 110 IAESFKLSQPFTQGLLDRGVLVVPFV 135