BP920235
Clone id YMU001_000134_F04
Library
Length 514
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000134_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGTGGATACCGGAAGGGTTGTTTGAGCTGCAGCCATGGACAAGAAATCTCTTTGAGAAC
ACAGCTACTGTCCAGTTTGATCACCGCGTACTTGCATTGACAACCTTAGCGTCAATAGTG
GCCATGTCGATTGTGGCTCGTAAATTAACTCTAGATCCTAGCATCCAAAGACTGGTCAAT
CTCACCATGGGTGTATCCATTCTTCAGGTGACGCTGGGGATTTCCACATTACTCTCATAT
GTTCCTGTATCTTTGGGAGTTGCCCATCAGGCTGGTGCTCTCTCCCTGTTCACTTCCATT
GTTGCATTGTTGCATGCATTGAAGAGGCCATCTCCAGCAGTATTACGGACCCTCATTCGA
TCCTAGCGAATTAAAAAAAAGGCGTTAGCTTTTCGTGTTCTGCTTTTGTGTCTACAGAGC
TAACAGCAGCTTTTAAAGGGCCTGATGAATATAATCCTCCGCATTATTCCTAAATCTGCC
AATACTTATCCTTGAAAGCCCATAGGAGGAGGTT
■■Homology search results ■■ -
sp_hit_id Q7KZN9
Definition sp|Q7KZN9|COX15_HUMAN Cytochrome c oxidase assembly protein COX15 homolog OS=Homo sapiens
Align length 108
Score (bit) 94.0
E-value 4.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920235|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_F04.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7KZN9|COX15_HUMAN Cytochrome c oxidase assembly protein COX1... 94 4e-19
sp|Q2Y9R4|CTAA_NITMU Heme A synthase OS=Nitrosospira multiformis... 94 5e-19
sp|Q08DG6|COX15_BOVIN Cytochrome c oxidase assembly protein COX1... 91 4e-18
sp|Q8BJ03|COX15_MOUSE Cytochrome c oxidase assembly protein COX1... 89 2e-17
sp|Q82X64|CTAA_NITEU Heme A synthase OS=Nitrosomonas europaea GN... 84 3e-16
sp|Q0AIG6|CTAA_NITEC Heme A synthase OS=Nitrosomonas eutropha (s... 83 9e-16
sp|P40086|COX15_YEAST Cytochrome c oxidase assembly protein COX1... 78 3e-14
sp|Q73HV8|CTAA_WOLPM Heme A synthase OS=Wolbachia pipientis wMel... 76 1e-13
sp|A6X1W1|CTAA_OCHA4 Heme A synthase OS=Ochrobactrum anthropi (s... 74 3e-13
sp|A7HXA1|CTAA_PARL1 Heme A synthase OS=Parvibaculum lavamentivo... 70 6e-12
sp|Q8G1D1|CTAA_BRUSU Heme A synthase OS=Brucella suis GN=ctaA PE... 70 6e-12
sp|B0CLB4|CTAA_BRUSI Heme A synthase OS=Brucella suis (strain AT... 70 6e-12
sp|A5VPX0|CTAA_BRUO2 Heme A synthase OS=Brucella ovis (strain AT... 70 6e-12
sp|Q8YGI7|CTAA_BRUME Heme A synthase OS=Brucella melitensis GN=c... 70 6e-12
sp|A9MAG4|CTAA_BRUC2 Heme A synthase OS=Brucella canis (strain A... 70 6e-12
sp|Q57DW5|CTAA_BRUAB Heme A synthase OS=Brucella abortus GN=ctaA... 70 6e-12
sp|Q2YNB0|CTAA_BRUA2 Heme A synthase OS=Brucella abortus (strain... 70 6e-12
sp|Q214F0|CTAA_RHOPB Heme A synthase OS=Rhodopseudomonas palustr... 69 1e-11
sp|Q1QKJ7|CTAA_NITHX Heme A synthase OS=Nitrobacter hamburgensis... 69 1e-11
sp|Q10361|ETP1_SCHPO Electron transfer protein 1, mitochondrial ... 68 2e-11
sp|Q5GSI0|CTAA_WOLTR Heme A synthase OS=Wolbachia sp. subsp. Bru... 68 2e-11
sp|Q3SSR2|CTAA_NITWN Heme A synthase OS=Nitrobacter winogradskyi... 68 2e-11
sp|A6U7T3|CTAA_SINMW Heme A synthase OS=Sinorhizobium medicae (s... 67 4e-11
sp|Q5HAH7|CTAA_EHRRW Heme A synthase OS=Ehrlichia ruminantium (s... 67 6e-11
sp|Q0BQ20|CTAA_GRABC Heme A synthase OS=Granulibacter bethesdens... 66 8e-11
sp|A9HEV3|CTAA_GLUDA Heme A synthase OS=Gluconacetobacter diazot... 65 1e-10
sp|A9IVC8|CTAA_BART1 Heme A synthase OS=Bartonella tribocorum (s... 65 1e-10
sp|Q7CZN9|CTAA_AGRT5 Heme A synthase OS=Agrobacterium tumefacien... 65 1e-10
sp|Q2K9W9|CTAA_RHIEC Heme A synthase OS=Rhizobium etli (strain C... 65 2e-10
sp|Q5FG54|CTAA_EHRRG Heme A synthase OS=Ehrlichia ruminantium (s... 65 2e-10

>sp|Q7KZN9|COX15_HUMAN Cytochrome c oxidase assembly protein COX15
homolog OS=Homo sapiens GN=COX15 PE=1 SV=1
Length = 410

Score = 94.0 bits (232), Expect = 4e-19
Identities = 45/108 (41%), Positives = 67/108 (62%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE LF P RN+FEN VQFDHR+L +T++ +I + ++R++ L +
Sbjct: 300 WIPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVT 359

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
+ ++ QV LGISTLL YVP L HQ+G+L+L T + L++ L+R
Sbjct: 360 LLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRR 407


>sp|Q2Y9R4|CTAA_NITMU Heme A synthase OS=Nitrosospira multiformis
(strain ATCC 25196 / NCIMB 11849) GN=ctaA PE=3 SV=1
Length = 356

Score = 93.6 bits (231), Expect = 5e-19
Identities = 49/108 (45%), Positives = 69/108 (63%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
+IP LF L+PW RN F+N TVQFDHR++A T + + +R + L S + L
Sbjct: 248 FIPPELFMLEPWYRNFFDNMTTVQFDHRLIAWTLAILVPIFWLKSRAVPLSGSARLACTL 307

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
+ + +Q+TLGISTLL VP++L AHQAGAL LFT+ + + H L+R
Sbjct: 308 LLIMLAVQITLGISTLLLVVPLTLAAAHQAGALLLFTAALWVNHELRR 355


>sp|Q08DG6|COX15_BOVIN Cytochrome c oxidase assembly protein COX15
homolog OS=Bos taurus GN=COX15 PE=2 SV=1
Length = 413

Score = 90.5 bits (223), Expect = 4e-18
Identities = 43/108 (39%), Positives = 66/108 (61%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE LF P RN+FEN VQFDHRVL + ++ ++ + ++R++ L +
Sbjct: 303 WIPEDLFTFSPLLRNVFENPTMVQFDHRVLGIASVTAVTVLYFLSRRIPLPRRTKIAATT 362

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
+ ++ QV LGISTLL YVP L HQ+G+L+L + + L++ L+R
Sbjct: 363 LLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLSVALWLMNELRR 410


>sp|Q8BJ03|COX15_MOUSE Cytochrome c oxidase assembly protein COX15
homolog OS=Mus musculus GN=Cox15 PE=2 SV=1
Length = 413

Score = 88.6 bits (218), Expect = 2e-17
Identities = 42/108 (38%), Positives = 66/108 (61%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE L P +N+FEN VQFDHR+L +T++ +I + ++R++ L +
Sbjct: 303 WIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAAVT 362

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
+ ++ QV LGISTLL YVP L HQ+G+L+L + + L++ L+R
Sbjct: 363 LLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRR 410


>sp|Q82X64|CTAA_NITEU Heme A synthase OS=Nitrosomonas europaea
GN=ctaA PE=3 SV=2
Length = 356

Score = 84.3 bits (207), Expect = 3e-16
Identities = 45/98 (45%), Positives = 63/98 (64%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
+IP LF L+PW RN F+N TVQFDHR++A + +I AR+L+L S + +L
Sbjct: 250 FIPPALFVLEPWYRNFFDNITTVQFDHRMIAWLLMFTIPLFWFKARQLSLSWSGRLACHL 309

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTS 297
+ + QV LGI+TLL VP++ AHQAGA+ LFT+
Sbjct: 310 LLIMLCTQVALGITTLLLSVPLTFAAAHQAGAVLLFTA 347


>sp|Q0AIG6|CTAA_NITEC Heme A synthase OS=Nitrosomonas eutropha
(strain C91) GN=ctaA PE=3 SV=1
Length = 356

Score = 82.8 bits (203), Expect = 9e-16
Identities = 43/97 (44%), Positives = 63/97 (64%)
Frame = +1

Query: 7 IPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNLT 186
IP +F L+PW RN F+N TVQFDHR++A + SI A++L+L S + +L
Sbjct: 251 IPPAMFVLEPWYRNFFDNITTVQFDHRLIAWLLIFSIPWFWFKAKQLSLSYSGRLACHLL 310

Query: 187 MGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTS 297
+ + ++Q LGI+TLL VP++ AHQAGA+ LFT+
Sbjct: 311 LLMLLIQAGLGITTLLLSVPLTFATAHQAGAVLLFTA 347


>sp|P40086|COX15_YEAST Cytochrome c oxidase assembly protein COX15
OS=Saccharomyces cerevisiae GN=COX15 PE=1 SV=1
Length = 486

Score = 77.8 bits (190), Expect = 3e-14
Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
Frame = +1

Query: 37 WTRNLFENTATVQFDHRVLALTTLASIVA--MSIVARKLTLDPSIQRLVNLTMGVSILQV 210
W RNL EN TVQ HR A S++A M + +K + + +++ MGV LQ
Sbjct: 353 WWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTSLHVMMGVVTLQA 412

Query: 211 TLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTLI 357
TLGI T+L VP+SL HQAGAL+L TS + L++P + +I
Sbjct: 413 TLGILTILYLVPISLASIHQAGALALLTSSLVFASQLRKPRAPMRNVII 461


>sp|Q73HV8|CTAA_WOLPM Heme A synthase OS=Wolbachia pipientis wMel
GN=ctaA PE=3 SV=1
Length = 350

Score = 75.9 bits (185), Expect = 1e-13
Identities = 44/121 (36%), Positives = 72/121 (59%)
Frame = +1

Query: 1 QWIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVN 180
Q +PE LF LQP N+FEN ATVQF HR LAL L +V +++ + ++ P L++
Sbjct: 237 QIVPEDLFFLQPTWLNIFENRATVQFIHRALALLILTLVVILTV--KNASIKPVYIMLLS 294

Query: 181 LTMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTLIR 360
+ I+Q+ LG+ TLL ++P+++ +AHQ + LF S + L L++ + + + T
Sbjct: 295 V-----IIQIILGVITLLLHIPIAIAIAHQVFSFILFGSSLYFLCYLRKQTTSPICTFFP 349

Query: 361 S 363
S
Sbjct: 350 S 350


>sp|A6X1W1|CTAA_OCHA4 Heme A synthase OS=Ochrobactrum anthropi
(strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaA PE=3
SV=1
Length = 357

Score = 74.3 bits (181), Expect = 3e-13
Identities = 44/106 (41%), Positives = 57/106 (53%)
Frame = +1

Query: 7 IPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNLT 186
IP LF PW RNLFEN TVQF HR+ A T L V S+ K + R +
Sbjct: 247 IPSDLFIQSPWWRNLFENPKTVQFVHRMFAYTVLVLTVLHSLQVWKQVPGTTHARRTIVL 306

Query: 187 MGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALK 324
+G+ ++Q +GI+TLL VP+ LG+ HQ AL + VA A K
Sbjct: 307 VGLVLIQAVIGIATLLMSVPLHLGLTHQFFALIVLAFAVAHWRATK 352


>sp|A7HXA1|CTAA_PARL1 Heme A synthase OS=Parvibaculum
lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
GN=ctaA PE=3 SV=1
Length = 344

Score = 70.1 bits (170), Expect = 6e-12
Identities = 44/108 (40%), Positives = 57/108 (52%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
+IP+GLF + P N FE+ TVQF HR+ A L +V ARK PS L
Sbjct: 241 FIPDGLFAMTPVWHNFFESHLTVQFQHRMTAYLLLLCVVWHWWAARKTAAAPSAGWLAVA 300

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
T Q +GI T+L VP+ LG AHQAGA+ +F V +H L +
Sbjct: 301 TFA----QACIGIWTVLWVVPIPLGAAHQAGAMVVFGVAVWHVHRLAK 344


tr_hit_id A9TT34
Definition tr|A9TT34|A9TT34_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 114
Score (bit) 147.0
E-value 2.0e-34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920235|Adiantum capillus-veneris mRNA, clone:
YMU001_000134_F04.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TT34|A9TT34_PHYPA Predicted protein OS=Physcomitrella paten... 147 2e-34
tr|Q9FKT8|Q9FKT8_ARATH Similarity to cytochrome oxidase assembly... 141 2e-32
tr|Q6Z5C5|Q6Z5C5_ORYSJ Os08g0496000 protein OS=Oryza sativa subs... 141 2e-32
tr|A3BUF9|A3BUF9_ORYSJ Putative uncharacterized protein OS=Oryza... 141 2e-32
tr|A2YWL5|A2YWL5_ORYSI Putative uncharacterized protein OS=Oryza... 141 2e-32
tr|B4FBK6|B4FBK6_MAIZE Putative uncharacterized protein OS=Zea m... 140 4e-32
tr|A7Q9G7|A7Q9G7_VITVI Chromosome chr19 scaffold_66, whole genom... 132 8e-30
tr|A4SB75|A4SB75_OSTLU Predicted protein OS=Ostreococcus lucimar... 110 3e-23
tr|O76740|O76740_DICDI Cytochrome c oxidase assembly protein OS=... 99 9e-20
tr|B3SBV7|B3SBV7_TRIAD Putative uncharacterized protein (Fragmen... 98 3e-19
tr|B6MXF1|B6MXF1_BRAFL Putative uncharacterized protein OS=Branc... 96 8e-19
tr|A7RII8|A7RII8_NEMVE Predicted protein OS=Nematostella vectens... 96 8e-19
tr|B7G2E3|B7G2E3_PHATR Predicted protein OS=Phaeodactylum tricor... 95 2e-18
tr|Q5R7F3|Q5R7F3_PONAB Putative uncharacterized protein DKFZp459... 94 4e-18
tr|B4DQM2|B4DQM2_HUMAN cDNA FLJ54125, highly similar to Cytochro... 94 4e-18
tr|A8K6I9|A8K6I9_HUMAN cDNA FLJ75721, highly similar to Homo sap... 94 4e-18
tr|Q7PY48|Q7PY48_ANOGA AGAP001744-PA OS=Anopheles gambiae GN=AGA... 94 5e-18
tr|Q292P6|Q292P6_DROPS GA17696 OS=Drosophila pseudoobscura pseud... 92 2e-17
tr|B4GCZ7|B4GCZ7_DROPE GL10912 OS=Drosophila persimilis GN=GL109... 92 2e-17
tr|B0XEF3|B0XEF3_CULQU Cytochrome c oxidase assembly protein COX... 92 2e-17
tr|Q4RQH4|Q4RQH4_TETNG Chromosome 17 SCAF15006, whole genome sho... 92 2e-17
tr|Q16M46|Q16M46_AEDAE Cytochrome c oxidase assembly protein cox... 92 2e-17
tr|B4J657|B4J657_DROGR GH21698 OS=Drosophila grimshawi GN=GH2169... 91 3e-17
tr|Q5K7Z7|Q5K7Z7_CRYNE Cytochrome c oxidase biogenesis-related p... 91 3e-17
tr|B4KMB5|B4KMB5_DROMO GI20711 OS=Drosophila mojavensis GN=GI207... 91 3e-17
tr|A9USM5|A9USM5_MONBE Predicted protein OS=Monosiga brevicollis... 91 3e-17
tr|Q6BL98|Q6BL98_DEBHA DEHA2F15246p OS=Debaryomyces hansenii GN=... 91 3e-17
tr|Q7ZV36|Q7ZV36_DANRE COX15 homolog, cytochrome c oxidase assem... 91 4e-17
tr|Q6NYV0|Q6NYV0_DANRE Cox15 protein OS=Danio rerio GN=cox15 PE=... 91 4e-17
tr|B4I8X3|B4I8X3_DROSE GM15488 OS=Drosophila sechellia GN=GM1548... 90 6e-17

>tr|A9TT34|A9TT34_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_150178 PE=4 SV=1
Length = 377

Score = 147 bits (372), Expect = 2e-34
Identities = 70/114 (61%), Positives = 91/114 (79%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPEGL +++P+ RN FENTATVQ DHR+LA +TL SIV M V RKL +DP ++ L+N
Sbjct: 247 WIPEGLMDMKPFFRNFFENTATVQLDHRILATSTLFSIVGMWAVTRKLPVDPRVRTLLNA 306

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVL 345
T G++ LQVTLGISTLL YVPVSLG AHQAGAL+LF+ +++L+H ++RP P +
Sbjct: 307 TFGMAALQVTLGISTLLMYVPVSLGTAHQAGALTLFSIVLSLVHGVRRPLPGFI 360


>tr|Q9FKT8|Q9FKT8_ARATH Similarity to cytochrome oxidase assembly
factor (Putative uncharacterized protein At5g56090)
(Putative uncharacterized protein At5g56090/MDA7_15)
OS=Arabidopsis thaliana GN=At5g56090/MDA7_15 PE=2 SV=1
Length = 457

Score = 141 bits (356), Expect = 2e-32
Identities = 68/117 (58%), Positives = 92/117 (78%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIP+ +FE++P RN FENTATVQ DHR+LA TTL +I M RKL + P+++ L+
Sbjct: 332 WIPDNIFEMKPLLRNFFENTATVQLDHRLLATTTLIAIGTMWWFTRKLDIHPAVKALIGS 391

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ +QVTLG+STLLSYVPVSLG AHQAGAL+L T ++ L H L+RPSP++L++L
Sbjct: 392 TVGMTAVQVTLGVSTLLSYVPVSLGSAHQAGALTLLTLMLLLNHTLRRPSPSLLKSL 448


>tr|Q6Z5C5|Q6Z5C5_ORYSJ Os08g0496000 protein OS=Oryza sativa subsp.
japonica GN=B1142B04.27 PE=2 SV=1
Length = 482

Score = 141 bits (355), Expect = 2e-32
Identities = 66/117 (56%), Positives = 92/117 (78%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE +F ++P+ RN FENT+TVQ +HR+LA TTL S+ + + ARK+ + P+I+ L+
Sbjct: 359 WIPEDVFAMEPFIRNFFENTSTVQLNHRILATTTLLSVGGLWLAARKVDMHPAIKSLIGS 418

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ LQVTLGISTLL YVP SLG AHQAGAL+L + ++ L H L+RPSPA+L++L
Sbjct: 419 TLGMAALQVTLGISTLLMYVPTSLGSAHQAGALTLLSLMILLTHTLRRPSPALLKSL 475


>tr|A3BUF9|A3BUF9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_026681 PE=4 SV=1
Length = 481

Score = 141 bits (355), Expect = 2e-32
Identities = 66/117 (56%), Positives = 92/117 (78%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE +F ++P+ RN FENT+TVQ +HR+LA TTL S+ + + ARK+ + P+I+ L+
Sbjct: 358 WIPEDVFAMEPFIRNFFENTSTVQLNHRILATTTLLSVGGLWLAARKVDMHPAIKSLIGS 417

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ LQVTLGISTLL YVP SLG AHQAGAL+L + ++ L H L+RPSPA+L++L
Sbjct: 418 TLGMAALQVTLGISTLLMYVPTSLGSAHQAGALTLLSLMILLTHTLRRPSPALLKSL 474


>tr|A2YWL5|A2YWL5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_29735 PE=4 SV=1
Length = 481

Score = 141 bits (355), Expect = 2e-32
Identities = 66/117 (56%), Positives = 92/117 (78%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE +F ++P+ RN FENT+TVQ +HR+LA TTL S+ + + ARK+ + P+I+ L+
Sbjct: 358 WIPEDVFAMEPFIRNFFENTSTVQLNHRILATTTLLSVGGLWLAARKVDMHPAIKSLIGS 417

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ LQVTLGISTLL YVP SLG AHQAGAL+L + ++ L H L+RPSPA+L++L
Sbjct: 418 TLGMAALQVTLGISTLLMYVPTSLGSAHQAGALTLLSLMILLTHTLRRPSPALLKSL 474


>tr|B4FBK6|B4FBK6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 483

Score = 140 bits (353), Expect = 4e-32
Identities = 64/117 (54%), Positives = 92/117 (78%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIPE +F ++P+ RN FENT+TVQ +HR+LA TTL S+ + + ARK+ + P+++ L+
Sbjct: 360 WIPEDVFSMEPFVRNFFENTSTVQLNHRILAATTLLSVGGLWLAARKIDMHPAVKSLIGS 419

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ LQVTLGISTLL+YVP SLG AHQAGAL+L + + L+H L+RPSPA L+++
Sbjct: 420 TLGMAALQVTLGISTLLTYVPTSLGSAHQAGALTLLSLTILLVHTLRRPSPARLKSI 476


>tr|A7Q9G7|A7Q9G7_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033466001
PE=4 SV=1
Length = 385

Score = 132 bits (333), Expect = 8e-30
Identities = 65/117 (55%), Positives = 89/117 (76%)
Frame = +1

Query: 4 WIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVNL 183
WIP+ +F ++P+ RN FENT+TVQ DHR+LA TL SI + RKL + P+++ L+
Sbjct: 262 WIPDDIFSMEPFIRNFFENTSTVQLDHRILATATLMSIGILWWSTRKLDIHPAVRFLIGN 321

Query: 184 TMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRPSPAVLRTL 354
T+G++ LQVTLGISTLLSYVPVSLG AHQAGAL+L + +V L H ++RPS +L++L
Sbjct: 322 TIGMAALQVTLGISTLLSYVPVSLGTAHQAGALTLLSLMVLLNHTVRRPSMFLLKSL 378


>tr|A4SB75|A4SB75_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_43606 PE=4 SV=1
Length = 367

Score = 110 bits (276), Expect = 3e-23
Identities = 62/114 (54%), Positives = 82/114 (71%), Gaps = 4/114 (3%)
Frame = +1

Query: 1 QWIPEGL---FELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLT-LDPSIQ 168
+WIPE +E + W RN FENTA VQFDHRVLALTTLAS+ A+ + R T L P +
Sbjct: 250 RWIPEEYLDQWEQKGW-RNFFENTAAVQFDHRVLALTTLASVSAVWLGHRNSTALHPRTR 308

Query: 169 RLVNLTMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKRP 330
L++ + + QVTLG++TLL +VPV LG AHQAGAL+LFT ++AL+H+L+ P
Sbjct: 309 MLLHALLATTAGQVTLGVTTLLHHVPVELGSAHQAGALTLFTVVLALMHSLRGP 362


>tr|O76740|O76740_DICDI Cytochrome c oxidase assembly protein
OS=Dictyostelium discoideum GN=coxA PE=4 SV=1
Length = 482

Score = 99.4 bits (246), Expect = 9e-20
Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 4/113 (3%)
Frame = +1

Query: 1 QWIPEGLF--ELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARK--LTLDPSIQ 168
QWIP+ + +++P +N+FE+ TVQF HRVLA T SI+A+S A + L L P +
Sbjct: 367 QWIPDDIINPKIKPAYKNMFEHDVTVQFQHRVLATITYGSILALSAFAYRGRLALSPKAR 426

Query: 169 RLVNLTMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
N + V QV LGI+TLL++VPVSLG AHQ G+L+L + + LLH LK+
Sbjct: 427 LATNCLLAVGTAQVALGITTLLTFVPVSLGAAHQTGSLTLLSVAIWLLHELKK 479


>tr|B3SBV7|B3SBV7_TRIAD Putative uncharacterized protein (Fragment)
OS=Trichoplax adhaerens GN=TRIADDRAFT_32984 PE=4 SV=1
Length = 348

Score = 97.8 bits (242), Expect = 3e-19
Identities = 51/109 (46%), Positives = 69/109 (63%)
Frame = +1

Query: 1 QWIPEGLFELQPWTRNLFENTATVQFDHRVLALTTLASIVAMSIVARKLTLDPSIQRLVN 180
+WIPE + + P RN EN+ T QF HRVL LTTL SI + AR LTL + N
Sbjct: 237 KWIPEDIMAISPKWRNFTENSTTAQFTHRVLGLTTLTSIFGLWCFARPLTLPRRARLATN 296

Query: 181 LTMGVSILQVTLGISTLLSYVPVSLGVAHQAGALSLFTSIVALLHALKR 327
+ +S +QV+LGI+TLL YVP L +HQAG+L LFT+ + L + L++
Sbjct: 297 CLLAMSGVQVSLGITTLLYYVPTPLAASHQAGSLLLFTNALWLAYELRK 345