BP920268
Clone id YMU001_000135_A06
Library
Length 274
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000135_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCAGCAGTCCATATGAGAGCGGCAGAAGCAAGAGCCCTTGCAGATGCGCATCATGGAGA
GGAGCTGTTGAAGGCAGAAGAACAGGCTGCCAAGTACAGGGCCTCGGGGAGCCTTCCTAT
GCTATATCCTTTTTGTTGTACATTCTGATATGAAATGGTGGGGCTTCTTCACAATCTTTT
ATACAATAAACAACCATTCCTTAAGCTCATGCTTGAGAATCCCCCAATGTCGAAGGGATA
TACTGTACAGGGTGTTGATATGCCCAAAAAATGG
■■Homology search results ■■ -
sp_hit_id Q4R7R1
Definition sp|Q4R7R1|YP022_MACFA 3-beta-HSD family protein HSPC105 homolog OS=Macaca fascicularis
Align length 65
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920268|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_A06.
(274 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4R7R1|YP022_MACFA 3-beta-HSD family protein HSPC105 homolog ... 30 3.8
sp|Q8WUS8|YP022_HUMAN 3-beta-HSD family protein HSPC105 OS=Homo ... 30 3.8

>sp|Q4R7R1|YP022_MACFA 3-beta-HSD family protein HSPC105 homolog
OS=Macaca fascicularis GN=QtsA-14586 PE=2 SV=1
Length = 393

Score = 30.0 bits (66), Expect = 3.8
Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 12/65 (18%)
Frame = +2

Query: 104 SGSLPMLYPFCCTF*YEMVGLLHNLLYNKQPFLK------------LMLENPPMSKGYTV 247
S LP+ +C F EMV + LYN QPFL LE GY
Sbjct: 279 STRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKA 338

Query: 248 QGVDM 262
Q D+
Sbjct: 339 QPFDL 343


>sp|Q8WUS8|YP022_HUMAN 3-beta-HSD family protein HSPC105 OS=Homo
sapiens GN=HSPC105 PE=2 SV=2
Length = 393

Score = 30.0 bits (66), Expect = 3.8
Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 12/65 (18%)
Frame = +2

Query: 104 SGSLPMLYPFCCTF*YEMVGLLHNLLYNKQPFLK------------LMLENPPMSKGYTV 247
S LP+ +C F EMV + LYN QPFL LE GY
Sbjct: 279 STRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKA 338

Query: 248 QGVDM 262
Q D+
Sbjct: 339 QPFDL 343


tr_hit_id Q97WQ2
Definition tr|Q97WQ2|Q97WQ2_SULSO Indolepyruvate ferredoxin oxidoreductase alpha subunit (IorA) OS=Sulfolobus solfataricus
Align length 42
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920268|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_A06.
(274 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q97WQ2|Q97WQ2_SULSO Indolepyruvate ferredoxin oxidoreductase ... 34 3.2
tr|Q4J6R6|Q4J6R6_SULAC Indolepyruvate ferredoxin oxidoreductase ... 33 9.4

>tr|Q97WQ2|Q97WQ2_SULSO Indolepyruvate ferredoxin oxidoreductase
alpha subunit (IorA) OS=Sulfolobus solfataricus GN=iorA
PE=4 SV=1
Length = 612

Score = 34.3 bits (77), Expect = 3.2
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = +2

Query: 95 YRASGSLPMLYPFCCTF*YEMVGLLHNLLYNKQPFLKLMLEN 220
YRA+G++P+ TF + + L N +YN+ P L L+L+N
Sbjct: 420 YRATGNIPIAVIGDSTFFHSGISALANAVYNQTPMLVLVLDN 461


>tr|Q4J6R6|Q4J6R6_SULAC Indolepyruvate ferredoxin oxidoreductase
alpha OS=Sulfolobus acidocaldarius GN=iorA PE=4 SV=1
Length = 611

Score = 32.7 bits (73), Expect = 9.4
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = +2

Query: 95 YRASGSLPMLYPFCCTF*YEMVGLLHNLLYNKQPFLKLMLEN 220
YRA+G++P+ TF + + L N +YNK P + L+L+N
Sbjct: 419 YRATGNIPVAIIGDSTFFHSGMSGLANAVYNKTPLVLLVLDN 460