BP920272
Clone id YMU001_000135_A10
Library
Length 503
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000135_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCTCAACTTGCTTGAGGAGCTGAACCTGTTCTAAAAGTTGCACCAATGTTGATTCCAAGG
TAAGAAGCTGCGAATGATTTTGCACCAACAGTTTGAGTGTTGATGGGTAAGAATCTGCAG
TGTTTTCTGAGAAAACTGATGACGAGGCTTGTGAATATGTTTTGGTAGGGGCAAGTCCAA
GTCCTGAAATTCCATCAGTAAATTCTGAGAGATCTCTAGACGTTTTTGCATGATCCATCT
CCCCACCCTCCGCAGAAAGTTGCACAAGATTATCAGAATTCTGCTTCGGCATTCCCTCCA
CAGCAACCACACCACTTTGGGGAATGTTCAAATATGGAGATTTGTCTGCCAAATTCTCCA
GTAAGGGGGACCTGCCAGAGCTGATAACTGGTGCTTGGTGTGGAATGTGCAATGCCGAGC
TTGCAAAAAGGTTTCCCAGAAATTCAGTTGTTGCCCGAACCCACCAAATGCTGTCTGCTG
TTAAACCTTCAAAAAAAGCAAGA
■■Homology search results ■■ -
sp_hit_id Q8H485
Definition sp|Q8H485|TLP11_ORYSJ Tubby-like F-box protein 11 OS=Oryza sativa subsp. japonica
Align length 135
Score (bit) 32.3
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920272|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_A10.
(503 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H485|TLP11_ORYSJ Tubby-like F-box protein 11 OS=Oryza sativ... 32 1.3
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=K... 32 1.7
sp|Q9NYF8|BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS... 32 1.7
sp|P52302|MBN_DROME Protein lethal(3)malignant blood neoplasm 1 ... 32 2.2
sp|Q16A32|TYPH_ROSDO Putative thymidine phosphorylase OS=Roseoba... 31 3.7
sp|Q7VFD7|HTPG_HELHP Chaperone protein htpG OS=Helicobacter hepa... 31 3.7
sp|Q465Y6|DNAK_METBF Chaperone protein dnaK OS=Methanosarcina ba... 31 3.7
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial... 27 4.2
sp|Q9UXR0|DNAK_METTE Chaperone protein dnaK OS=Methanosarcina th... 30 4.9
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic sub... 30 6.4
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1... 30 6.4
sp|Q5B993|ATG11_EMENI Autophagy-related protein 11 OS=Emericella... 30 6.4

>sp|Q8H485|TLP11_ORYSJ Tubby-like F-box protein 11 OS=Oryza sativa
subsp. japonica GN=TULP11 PE=2 SV=1
Length = 406

Score = 32.3 bits (72), Expect = 1.3
Identities = 39/135 (28%), Positives = 56/135 (41%), Gaps = 11/135 (8%)
Frame = -2

Query: 448 TEFLGNLFASSALHIPHQAPVISSGRSPLL---ENLADKSPYLNIPQSGVVAVEGMPKQN 278
+ FLG F H P+ VIS G+S + +L+ + P N P S +
Sbjct: 192 SNFLGTKFTIYDAHPPYAGDVISKGQSARVIGSNHLSPRIPAGNYPVSHI---------- 241

Query: 277 SDNLVQLSAEGGEMDH-AKTSRDLSEFTDGISGLGLAPTKT-----YSQASSSV--FSEN 122
S L L + G H A S +S G G APT+T Y ++ +S+ F
Sbjct: 242 SYELNVLGSRGPRRMHCAMDSIPVSAIEQG----GTAPTQTEFPLSYHESFTSIPFFKSK 297

Query: 121 TADSYPSTLKLLVQN 77
+ + ST LL QN
Sbjct: 298 SVRANNSTASLLTQN 312


>sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4
PE=1 SV=3
Length = 513

Score = 32.0 bits (71), Expect = 1.7
Identities = 19/54 (35%), Positives = 23/54 (42%)
Frame = +1

Query: 205 LRDL*TFLHDPSPHPPQKVAQDYQNSASAFPPQQPHHFGECSNMEICLPNSPVR 366
L DL L + HPP+ VA +SASA P G S C P+R
Sbjct: 102 LLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIR 155


>sp|Q9NYF8|BCLF1_HUMAN Bcl-2-associated transcription factor 1
OS=Homo sapiens GN=BCLAF1 PE=1 SV=2
Length = 920

Score = 32.0 bits (71), Expect = 1.7
Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%)
Frame = -2

Query: 418 SALHIPHQAPVISSGRSPLLENLADKSPYLNIPQ----SGVVAVEGMPKQNSDNLVQLSA 251
S H P ++ S G + + SP +IP + +A + P+ S
Sbjct: 264 SIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYP 323

Query: 250 EGGEMDHAKTSRDLSEFTD 194
+GG+ + AKT + L FTD
Sbjct: 324 DGGDQETAKTGKFLKRFTD 342


>sp|P52302|MBN_DROME Protein lethal(3)malignant blood neoplasm 1
OS=Drosophila melanogaster GN=l(3)mbn PE=2 SV=2
Length = 653

Score = 31.6 bits (70), Expect = 2.2
Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 5/59 (8%)
Frame = -2

Query: 403 PHQAPVISSGRSPLLENLADKSPYLNIPQSGVVAVEGMPKQN-----SDNLVQLSAEGG 242
PHQ P++SS +P + + +P N+P +G G N S ++ A GG
Sbjct: 396 PHQTPLLSSATAPGISGVTANTPTGNVPSNGGGIAAGKAPGNPQAGGSGGIIGAGAPGG 454


>sp|Q16A32|TYPH_ROSDO Putative thymidine phosphorylase
OS=Roseobacter denitrificans (strain ATCC 33942 / OCh
114) GN=RD1_1528 PE=3 SV=1
Length = 677

Score = 30.8 bits (68), Expect = 3.7
Identities = 13/47 (27%), Positives = 25/47 (53%)
Frame = -2

Query: 331 LNIPQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTSRDLSEFTDG 191
L+ + VV++E P S +++Q GGE+ HA+ + + +G
Sbjct: 257 LDAVEGDVVSIERSPTPKSRSILQKKVRGGELSHAEMEAFIHDLVNG 303


>sp|Q7VFD7|HTPG_HELHP Chaperone protein htpG OS=Helicobacter
hepaticus GN=htpG PE=3 SV=1
Length = 618

Score = 30.8 bits (68), Expect = 3.7
Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 13/139 (9%)
Frame = -2

Query: 463 WVRATTEFLGNLFASSALHIPHQAPV------ISSGRSPLLENLA----DKS---PYLNI 323
W+ E GNL ++ +IP +AP SG ++ + DK PYL
Sbjct: 267 WIHTKVE--GNLEYTTLFYIPQKAPFDLFRVDYQSGVKLYVKRVFITDDDKELLPPYLRF 324

Query: 322 PQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTSRDLSEFTDGISGLGLAPTKTYSQAS 143
+ GV+ E +P S ++Q + + A T + LSE T+ A KT+ +
Sbjct: 325 VR-GVIDSEDLPLNVSREILQQNKILANIKSASTKKILSEITN--IAKNEADYKTFYEQF 381

Query: 142 SSVFSENTADSYPSTLKLL 86
V E Y + K+L
Sbjct: 382 GKVLKEGLYGDYENKEKIL 400


>sp|Q465Y6|DNAK_METBF Chaperone protein dnaK OS=Methanosarcina
barkeri (strain Fusaro / DSM 804) GN=dnaK PE=3 SV=1
Length = 620

Score = 30.8 bits (68), Expect = 3.7
Identities = 28/93 (30%), Positives = 35/93 (37%), Gaps = 5/93 (5%)
Frame = -2

Query: 364 LLENLADKSPYLNIPQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTSRDLSEFTDGIS 185
L+EN K PY NI VA+ +Q GGE+ D++ T GI
Sbjct: 326 LVENFTGKKPYKNINPDEAVAIGA--------AIQAGVLGGEVKDV-LLLDVTPLTLGIE 376

Query: 184 GLG-----LAPTKTYSQASSSVFSENTADSYPS 101
LG L P T S AD+ PS
Sbjct: 377 TLGGIATPLIPRNTTIPTKKSQVFSTAADNQPS 409


>sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial
OS=Homo sapiens GN=AIFM1 PE=1 SV=1
Length = 613

Score = 26.9 bits (58), Expect(2) = 4.2
Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
Frame = -2

Query: 268 LVQLSAEGGEMDHAKTSR-DLSEFTDGISGLGLAPTKTYSQA--SSSVFSENTADSYPST 98
+V LS G KT + D + + ISGLGL P + +A S+S E D PS
Sbjct: 72 IVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSH 131

Query: 97 LKLLV 83
+ L+
Sbjct: 132 VPFLL 136



Score = 21.6 bits (44), Expect(2) = 4.2
Identities = 8/21 (38%), Positives = 12/21 (57%)
Frame = -1

Query: 398 PSTSYQLWQVPLTGEFGRQIS 336
P +Q W VPL + RQ++
Sbjct: 35 PGNLFQRWHVPLELQMTRQMA 55


>sp|Q9UXR0|DNAK_METTE Chaperone protein dnaK OS=Methanosarcina
thermophila GN=dnaK PE=3 SV=1
Length = 610

Score = 30.4 bits (67), Expect = 4.9
Identities = 28/93 (30%), Positives = 35/93 (37%), Gaps = 5/93 (5%)
Frame = -2

Query: 364 LLENLADKSPYLNIPQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTSRDLSEFTDGIS 185
L+EN K PY NI VA+ +Q GGE+ D++ T GI
Sbjct: 326 LVENFTGKKPYKNINPDEAVAIGA--------AIQAGVLGGEVKDI-LLLDVTPLTLGIE 376

Query: 184 GLG-----LAPTKTYSQASSSVFSENTADSYPS 101
LG L P T S AD+ PS
Sbjct: 377 TLGGIATPLIPRNTTIPTRKSQIFSTAADNQPS 409


>sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic
subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3
Length = 4128

Score = 30.0 bits (66), Expect = 6.4
Identities = 14/30 (46%), Positives = 19/30 (63%)
Frame = -3

Query: 300 WRECRSRILIILCNFLRRVGRWIMQKRLEI 211
+RECR IL LC FL ++G+ I +EI
Sbjct: 78 FRECREEILKFLCIFLEKMGQKIAPYSVEI 107


tr_hit_id Q9XID7
Definition tr|Q9XID7|Q9XID7_ARATH F23M19.1 protein (Late embryogenesis abundant protein, putative; 78257-75162) OS=Arabidopsis thaliana
Align length 100
Score (bit) 66.6
E-value 6.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920272|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_A10.
(503 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9XID7|Q9XID7_ARATH F23M19.1 protein (Late embryogenesis abun... 67 6e-10
tr|A7QCH9|A7QCH9_VITVI Chromosome chr12 scaffold_78, whole genom... 62 2e-08
tr|A7QN19|A7QN19_VITVI Chromosome undetermined scaffold_129, who... 61 3e-08
tr|B6U4K5|B6U4K5_MAIZE Embryogenesis-associated protein EMB8 OS=... 59 1e-07
tr|Q6I5U7|Q6I5U7_ORYSJ Os05g0432600 protein OS=Oryza sativa subs... 55 2e-06
tr|Q5NA00|Q5NA00_ORYSJ Putative lung alpha/beta hydrolase protei... 55 2e-06
tr|B8A6Z5|B8A6Z5_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A3A015|A3A015_ORYSJ Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A2Y501|A2Y501_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|A9RFH1|A9RFH1_PHYPA Predicted protein OS=Physcomitrella paten... 47 4e-04
tr|Q9LTX5|Q9LTX5_ARATH Similarity to alpha/beta hydrolase OS=Ara... 39 0.11
tr|Q54DV1|Q54DV1_DICDI Putative uncharacterized protein OS=Dicty... 36 1.2
tr|Q91C47|Q91C47_HBV Polymerase OS=Hepatitis B virus PE=4 SV=1 35 1.5
tr|A3LD98|A3LD98_PSEAE Putative uncharacterized protein OS=Pseud... 35 1.5
tr|Q02QD4|Q02QD4_PSEAB Putative lysophospholipase OS=Pseudomonas... 35 2.0
tr|A4AKI8|A4AKI8_9ACTN Ribonucleoside-diphosphate reductase OS=m... 35 2.6
tr|B4WGU6|B4WGU6_9SYNE Putative uncharacterized protein OS=Synec... 34 3.4
tr|A4FSH2|A4FSH2_9INSE Putative uncharacterized protein (Fragmen... 34 3.4
tr|B5RTD0|B5RTD0_DEBHA DEHA2C17028p OS=Debaryomyces hansenii GN=... 34 3.4
tr|Q5GV88|Q5GV88_XANOR Disulphide-isomerase OS=Xanthomonas oryza... 34 4.5
tr|Q2NYG2|Q2NYG2_XANOM Disulphide-isomerase OS=Xanthomonas oryza... 34 4.5
tr|B2SL27|B2SL27_XANOP Disulphide-isomerase OS=Xanthomonas oryza... 34 4.5
tr|Q4P119|Q4P119_USTMA Putative uncharacterized protein OS=Ustil... 34 4.5
tr|B2WI95|B2WI95_PYRTR Predicted protein OS=Pyrenophora tritici-... 34 4.5
tr|A1D7A6|A1D7A6_NEOFI RNA binding domain protein OS=Neosartorya... 34 4.5
tr|A6V2C1|A6V2C1_PSEA7 Putative uncharacterized protein OS=Pseud... 33 5.8
tr|A5GSQ5|A5GSQ5_SYNR3 NAD dependent epimerase/dehydratase OS=Sy... 33 5.8
tr|B2D6W1|B2D6W1_VIBCH Putative uncharacterized protein OS=Vibri... 33 5.8
tr|A6ABK8|A6ABK8_VIBCH Putative uncharacterized protein OS=Vibri... 33 5.8
tr|Q6XYW3|Q6XYW3_SPIKU DNA-directed RNA polymerase alpha subunit... 33 7.6

>tr|Q9XID7|Q9XID7_ARATH F23M19.1 protein (Late embryogenesis
abundant protein, putative; 78257-75162) OS=Arabidopsis
thaliana GN=F7P12.5 PE=4 SV=1
Length = 530

Score = 66.6 bits (161), Expect = 6e-10
Identities = 41/100 (41%), Positives = 52/100 (52%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPLLENLADKSPYLNI 323
LAFFEGLT S+WWVRAT EFLG L S +HI SSG S E ++ PYLNI
Sbjct: 390 LAFFEGLTGSSLWWVRATNEFLGVLSCSPYMHIQKIVDKRSSG-SGKQEPSINQGPYLNI 448

Query: 322 PQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTSRDLSE 203
+ G+VA + + N L G + + T + E
Sbjct: 449 AEDGLVA--AVKYEQDTNKTTLKQRGRKPEEDVTKKSFKE 486


>tr|A7QCH9|A7QCH9_VITVI Chromosome chr12 scaffold_78, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035401001
PE=4 SV=1
Length = 568

Score = 61.6 bits (148), Expect = 2e-08
Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPL---LENLADKSPY 332
L FFEGLTA S+WWVRA EF L ++ +H +A V SPL LE+ D+ PY
Sbjct: 386 LGFFEGLTAKSLWWVRAVDEFFNVLHSTEFIHRKKEAQV-----SPLPVPLESSIDQGPY 440

Query: 331 LNIPQSGVVAVEGMPKQNSDNLVQLSAE 248
+N+ + G+V G + N + +L E
Sbjct: 441 VNVTKDGMVTAIGNKQTNMEEEEELCHE 468


>tr|A7QN19|A7QN19_VITVI Chromosome undetermined scaffold_129, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00002309001 PE=4 SV=1
Length = 570

Score = 61.2 bits (147), Expect = 3e-08
Identities = 36/95 (37%), Positives = 53/95 (55%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPLLENLADKSPYLNI 323
LAFFEG+ A S+WWVRA EFL L +S +H + +I LE+ D+ PY+N
Sbjct: 391 LAFFEGIAATSLWWVRAVDEFLSVLHSSPFMHKQKKVQIIPHSS---LESAIDQGPYVNF 447

Query: 322 PQSGVVAVEGMPKQNSDNLVQLSAEGGEMDHAKTS 218
+ G+VA G + + +V +EG + H K+S
Sbjct: 448 AEDGMVAAMG--NEQTSTVVGPLSEGQNI-HDKSS 479


>tr|B6U4K5|B6U4K5_MAIZE Embryogenesis-associated protein EMB8 OS=Zea
mays PE=2 SV=1
Length = 571

Score = 58.9 bits (141), Expect = 1e-07
Identities = 40/97 (41%), Positives = 56/97 (57%), Gaps = 10/97 (10%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALH--IPHQAPVISSGRSPLLENLADKSPYL 329
LAFF+GLTA +WWV AT+EFL L SS +H + ++SS LE+ DKSPY+
Sbjct: 385 LAFFQGLTARRLWWVGATSEFLSALHDSSYMHRQKANDHVLLSS-----LESSIDKSPYV 439

Query: 328 NIPQSGVVAV--------EGMPKQNSDNLVQLSAEGG 242
N+ + G+VA +G P ++ + QLS E G
Sbjct: 440 NLMEDGMVAAVTKDGPSNDGSPLNHAAD-EQLSNEAG 475


>tr|Q6I5U7|Q6I5U7_ORYSJ Os05g0432600 protein OS=Oryza sativa subsp.
japonica GN=OJ1378_A04.11 PE=2 SV=1
Length = 581

Score = 55.1 bits (131), Expect = 2e-06
Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPLLENLADKSPYLNI 323
LAFF+GLTA +WWV A +EFL L S + H+ LE+ DKSPY+N
Sbjct: 389 LAFFQGLTAGKLWWVGAVSEFLLALHDSPCM---HRQKAQEHSLHTSLESSIDKSPYVNF 445

Query: 322 PQSGVV-AVEGMPKQNSDNLVQLSAE 248
+ G+V AV NSD+ +S E
Sbjct: 446 MEDGMVTAVTNDDANNSDSDNPISNE 471


>tr|Q5NA00|Q5NA00_ORYSJ Putative lung alpha/beta hydrolase protein 1
(Os01g0871100 protein) OS=Oryza sativa subsp. japonica
GN=P0039A07.22 PE=4 SV=1
Length = 582

Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPH-QAPVISSGRSPLLENLADKSPYLN 326
LAFF+GLTA +WWV A +EFL L S +H Q ++ S LE+ DKSPY+N
Sbjct: 390 LAFFQGLTAGRLWWVGAVSEFLFALLDSKYMHQQKAQDHILRSS----LESSIDKSPYVN 445

Query: 325 IPQSGVVA 302
+ + G++A
Sbjct: 446 VMEDGMIA 453


>tr|B8A6Z5|B8A6Z5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04599 PE=4 SV=1
Length = 582

Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPH-QAPVISSGRSPLLENLADKSPYLN 326
LAFF+GLTA +WWV A +EFL L S +H Q ++ S LE+ DKSPY+N
Sbjct: 390 LAFFQGLTAGRLWWVGAVSEFLFALLDSKYMHQQKAQDHILHSS----LESSIDKSPYVN 445

Query: 325 IPQSGVVA 302
+ + G++A
Sbjct: 446 VMEDGMIA 453


>tr|A3A015|A3A015_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004137 PE=4 SV=1
Length = 549

Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPH-QAPVISSGRSPLLENLADKSPYLN 326
LAFF+GLTA +WWV A +EFL L S +H Q ++ S LE+ DKSPY+N
Sbjct: 357 LAFFQGLTAGRLWWVGAVSEFLFALLDSKYMHQQKAQDHILRSS----LESSIDKSPYVN 412

Query: 325 IPQSGVVA 302
+ + G++A
Sbjct: 413 VMEDGMIA 420


>tr|A2Y501|A2Y501_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20077 PE=4 SV=1
Length = 581

Score = 55.1 bits (131), Expect = 2e-06
Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPLLENLADKSPYLNI 323
LAFF+GLTA +WWV A +EFL L S + H+ LE+ DKSPY+N
Sbjct: 389 LAFFQGLTAGKLWWVGAVSEFLLALHDSPCM---HRQKAQEHSLHTSLESSIDKSPYVNF 445

Query: 322 PQSGVV-AVEGMPKQNSDNLVQLSAE 248
+ G+V AV NSD+ +S E
Sbjct: 446 MEDGMVTAVTNDDANNSDSDNPISNE 471


>tr|A9RFH1|A9RFH1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_55167 PE=4 SV=1
Length = 587

Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/69 (33%), Positives = 39/69 (56%)
Frame = -2

Query: 502 LAFFEGLTADSIWWVRATTEFLGNLFASSALHIPHQAPVISSGRSPLLENLADKSPYLNI 323
LA+FEG T +IWW RA EF+ + S+ +H P + +S N+ + PY+N+
Sbjct: 395 LAYFEGFTGRTIWWTRALIEFMTIMIPSNLMHTPQK---VSEDEKKFDLNVCN-GPYVNV 450

Query: 322 PQSGVVAVE 296
SG++ ++
Sbjct: 451 SSSGLLYLQ 459