BP920310
Clone id YMU001_000135_E08
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000135_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCGACAGACAACCAAGGTGTACCAGGCCTGAGAAGAACCTGGCCTCTACCCTCCATCA
AATAGTACCGCAACATCGGAACGTGACGATTGGTGTGGCCAAGTGGGCCTTCGACAGACT
GCTCGCAACATCAGAGAAAGAGCAATGGGACAAGCCCACAGGAAACCCCATCCTTTGAGG
GGCAGAAGCCCTAACAAAGATAGTAGCTCATCTAGTAGGAGAGGGAGACCAACTGCATGA
AGCCCCAACCTCATTAGAAGCGTGGGCAGAGCTAGTGAACCAATGCCAAGAGGCCGAGCA
ACACCTTCTTGTTCAGCAGCACCCAAAGTAAGGAAGCCTAATAAGACGACACAATCGAAA
TACCTCAGAGATGAGGGAGCCACCAGCTCGGAGGAGGTGCTCTCGGAAAGTGACGAAGAC
AAAGTGGAGTTAGCACCAGAAGAAGAGGGCCGGCTAGAAAGAAAACCAAAACCCGTTCTC
CAACAAAGAATATGGAGCAGATAGAA
■■Homology search results ■■ -
sp_hit_id Q9P7J1
Definition sp|Q9P7J1|SWT1_SCHPO Transcriptional protein swt1 OS=Schizosaccharomyces pombe
Align length 70
Score (bit) 34.3
E-value 0.34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920310|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_E08.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9P7J1|SWT1_SCHPO Transcriptional protein swt1 OS=Schizosacch... 34 0.34
sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapi... 32 2.2
sp|Q5F556|NADD_NEIG1 Probable nicotinate-nucleotide adenylyltran... 31 3.8
sp|Q9CP74|RNB_PASMU Exoribonuclease 2 OS=Pasteurella multocida G... 30 8.4

>sp|Q9P7J1|SWT1_SCHPO Transcriptional protein swt1
OS=Schizosaccharomyces pombe GN=swt1 PE=2 SV=1
Length = 462

Score = 34.3 bits (77), Expect = 0.34
Identities = 23/70 (32%), Positives = 32/70 (45%)
Frame = -3

Query: 282 WFTSSAHASNEVGASCSWSPSPTR*ATIFVRASAPQRMGFPVGLSHCSFSDVASSLSKAH 103
W TS + +E+ S SPSP+ A+ AS P R P+GL + + S LS
Sbjct: 25 WSTSHIPSLSEINPSSFQSPSPSPFASSTSLASKPARYSKPLGLFVLDTNFLLSHLSLCQ 84

Query: 102 LATPIVTFRC 73
+T RC
Sbjct: 85 NLIEFLTARC 94


>sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens
GN=DNAH6 PE=1 SV=3
Length = 4158

Score = 31.6 bits (70), Expect = 2.2
Identities = 18/52 (34%), Positives = 26/52 (50%)
Frame = -3

Query: 168 GFPVGLSHCSFSDVASSLSKAHLATPIVTFRCCGTI*WRVEARFFSGLVHLG 13
G P G + ++ L+KA LA V F C + +++ RFFSGL G
Sbjct: 1468 GAPAGPAGTGKTETTKDLAKA-LAIQCVVFNCSDGLDYKMMGRFFSGLAQSG 1518


>sp|Q5F556|NADD_NEIG1 Probable nicotinate-nucleotide
adenylyltransferase OS=Neisseria gonorrhoeae (strain
ATCC 700825 / FA 1090) GN=nadD PE=3 SV=1
Length = 201

Score = 30.8 bits (68), Expect = 3.8
Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 2/71 (2%)
Frame = +2

Query: 203 VAHLVGEGDQLHEAPTSLEAWAELVNQCQEAEQHLLVQQHPK*GSLIRRHNRNTSEMRE- 379
+A + +GD LH+ P L AW L N Q+ +L S R N + + + +
Sbjct: 127 IAVAMRQGDSLHQTPRELHAW--LGNALQDGSVRILSAPMHNVSSTEIRRNLSAAGVSDG 184

Query: 380 -PPARRRCSRK 409
PPA R RK
Sbjct: 185 IPPAAARYIRK 195


>sp|Q9CP74|RNB_PASMU Exoribonuclease 2 OS=Pasteurella multocida
GN=rnb PE=3 SV=1
Length = 658

Score = 29.6 bits (65), Expect = 8.4
Identities = 17/50 (34%), Positives = 26/50 (52%)
Frame = +2

Query: 11 QPRCTRPEKNLASTLHQIVPQHRNVTIGVAKWAFDRLLATSEKEQWDKPT 160
Q C +P+ +L L + Q+R V +A W + R LAT ++ KPT
Sbjct: 532 QQTCEKPQDDLFVRLQEARRQNRLVERDIADWLYCRYLATQVEQ---KPT 578


tr_hit_id Q2U7G0
Definition tr|Q2U7G0|Q2U7G0_ASPOR Predicted protein OS=Aspergillus oryzae
Align length 53
Score (bit) 35.8
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920310|Adiantum capillus-veneris mRNA, clone:
YMU001_000135_E08.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2U7G0|Q2U7G0_ASPOR Predicted protein OS=Aspergillus oryzae G... 36 1.2
tr|B8NFI4|B8NFI4_ASPFL Putative uncharacterized protein OS=Asper... 36 1.2
tr|A8BFS2|A8BFS2_GIALA Dynein heavy chain OS=Giardia lamblia ATC... 35 1.6
tr|Q0APE0|Q0APE0_MARMM OmpA/MotB domain protein OS=Maricaulis ma... 35 2.7
tr|Q69WH9|Q69WH9_ORYSJ Putative uncharacterized protein P0531C01... 34 4.6
tr|Q391C9|Q391C9_BURS3 Aldo/keto reductase OS=Burkholderia sp. (... 33 6.0

>tr|Q2U7G0|Q2U7G0_ASPOR Predicted protein OS=Aspergillus oryzae
GN=AO090701000854 PE=4 SV=1
Length = 664

Score = 35.8 bits (81), Expect = 1.2
Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%)
Frame = -1

Query: 158 WACPIALSLMLRAVCRRPTWPHQSSRSDVAVLF-----DGG*RPGSSQAWYTL 15
WAC IA+ + R + P WP S+ + + +GG GSS+ WY L
Sbjct: 333 WACDIAIDFIRRFLTNTPAWPQFSAEAARHLALPECEKNGGVMSGSSRQWYEL 385


>tr|B8NFI4|B8NFI4_ASPFL Putative uncharacterized protein
OS=Aspergillus flavus NRRL3357 GN=AFLA_063180 PE=4 SV=1
Length = 651

Score = 35.8 bits (81), Expect = 1.2
Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%)
Frame = -1

Query: 158 WACPIALSLMLRAVCRRPTWPHQSSRSDVAVLF-----DGG*RPGSSQAWYTL 15
WAC IA+ + R + P WP S+ + + +GG GSS+ WY L
Sbjct: 249 WACDIAIDFIRRFLTNTPAWPQFSAEAARHLALPECEKNGGVMSGSSRQWYEL 301


>tr|A8BFS2|A8BFS2_GIALA Dynein heavy chain OS=Giardia lamblia ATCC
50803 GN=GL50803_101138 PE=4 SV=1
Length = 5163

Score = 35.4 bits (80), Expect = 1.6
Identities = 18/52 (34%), Positives = 29/52 (55%)
Frame = -3

Query: 168 GFPVGLSHCSFSDVASSLSKAHLATPIVTFRCCGTI*WRVEARFFSGLVHLG 13
G P G + ++ L+KA LA P + F C ++ +R+ RFF+GL +G
Sbjct: 1974 GAPQGPAGTGKTETTKDLAKA-LAMPCIVFNCSESLDYRIMGRFFAGLSQVG 2024


>tr|Q0APE0|Q0APE0_MARMM OmpA/MotB domain protein OS=Maricaulis maris
(strain MCS10) GN=Mmar10_1555 PE=4 SV=1
Length = 307

Score = 34.7 bits (78), Expect = 2.7
Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 6/101 (5%)
Frame = +2

Query: 131 SEKEQWDKPTGNPIL*GAEALTKIVAHLVGEGDQ------LHEAPTSLEAWAELVNQCQE 292
+++++ P G+P E++T+I A + E Q LH A SL + + + E
Sbjct: 108 NDRDRQQTPEGSPE--AVESVTEITASAMAEAQQRRDAAELHSASMSLRQAMQEMPELAE 165

Query: 293 AEQHLLVQQHPK*GSLIRRHNRNTSEMREPPARRRCSRKVT 415
H+L+ + P+ G I+ ++ M +P A R R VT
Sbjct: 166 LSNHVLIDETPE-GLRIQLIDQEGRPMFDPGATRPNERAVT 205


>tr|Q69WH9|Q69WH9_ORYSJ Putative uncharacterized protein P0531C01.11
(Putative uncharacterized protein P0577H07.19) OS=Oryza
sativa subsp. japonica GN=P0531C01.11 PE=4 SV=1
Length = 120

Score = 33.9 bits (76), Expect = 4.6
Identities = 15/38 (39%), Positives = 20/38 (52%)
Frame = +1

Query: 61 NSTATSERDDWCGQVGLRQTARNIRERAMGQAHRKPHP 174
+S+ R DWCG GLR + R +A+G A P P
Sbjct: 11 SSSRLCRRQDWCGDDGLRASDGRRRAKAVGHARSIPRP 48


>tr|Q391C9|Q391C9_BURS3 Aldo/keto reductase OS=Burkholderia sp.
(strain 383) GN=Bcep18194_B2826 PE=4 SV=1
Length = 340

Score = 33.5 bits (75), Expect = 6.0
Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
Frame = +2

Query: 29 PEKNLASTLHQIVPQHRNVTIGVAK---WAFDRLLATSEKEQWDKP 157
P + STLH IV + IGV+ W F +++ E+ WDKP
Sbjct: 134 PVEETMSTLHDIVRAGKARYIGVSTMYTWQFAKIMQACERNGWDKP 179