BP920343
Clone id YMU001_000136_A05
Library
Length 334
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCAGAAGCCTTTGATCTGTAGCACTCTGCAAGACTTCGTCTCTTCACAGAAGGCTTTGA
CATATAGCACCGACCTACAAAACGCTAGCCTCGGAGTTCGAACACCAGGTCTCGTGGCAC
TCTCGCAGAGAGACCCCAAGCTTGGTATAAACATCACCTTCACAGGCACTGAATGCAACG
GCCCCAACCTGCATACACGATGTTCCCTTCACACTCCCTCGGCTTCAGTGCACCGAACAC
ACGCACAGATTGCGCTGCAAAGACTTGTTGAAGCCGATCCGACACATAAGTGCCATCTTC
GAACTCCCTTAGCATCAATGCACCCACGCACGTG
■■Homology search results ■■ -
sp_hit_id O88278
Definition sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus
Align length 68
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920343|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_A05.
(334 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor ... 32 1.3
sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type recepto... 32 1.3
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=H... 31 2.2
sp|O83823|Y851_TREPA Uncharacterized protein TP_0851 OS=Treponem... 30 2.9
sp|O84000|Y1037_TREPA UPF0073 membrane protein TP_1037 OS=Trepon... 30 3.8
sp|Q92M99|GLMM_RHIME Phosphoglucosamine mutase OS=Rhizobium meli... 30 3.8
sp|P79926|HNF4B_XENLA Hepatocyte nuclear factor 4-beta OS=Xenopu... 30 4.9
sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type recepto... 30 4.9
sp|A6UCS2|GLMM_SINMW Phosphoglucosamine mutase OS=Sinorhizobium ... 29 6.4
sp|B0YPN0|MATK_ANEMR Maturase K OS=Aneura mirabilis GN=matK PE=3... 29 8.4

>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3
OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1
Length = 3313

Score = 31.6 bits (70), Expect = 1.3
Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
Frame = -2

Query: 306 EFEDGTYVSDRLQQVF--AAQSVRVFGALKPRECEGNIVYAGWGRCIQCL*R*CLYQAWG 133
E ED R Q+ AAQS R+ P++ +GN + + W +C C QAWG
Sbjct: 2911 ESEDNGRTRGRFQRPLRRAAQSERLLA--HPKDVDGNDLLSYWPALGECEAAPCALQAWG 2968

Query: 132 LSARVPRD 109
R+ D
Sbjct: 2969 SERRLGLD 2976


>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3
OS=Mus musculus GN=Celsr3 PE=2 SV=1
Length = 3301

Score = 31.6 bits (70), Expect = 1.3
Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
Frame = -2

Query: 306 EFEDGTYVSDRLQQVF--AAQSVRVFGALKPRECEGNIVYAGWGRCIQCL*R*CLYQAWG 133
E ED R Q+ AAQS R+ P++ +GN + + W +C C QAWG
Sbjct: 2903 ESEDNGRTRGRFQRPLRRAAQSERLLA--HPKDVDGNDLLSYWPALGECEAAPCALQAWG 2960

Query: 132 LSARVPRD 109
R+ D
Sbjct: 2961 SERRLGLD 2968


>sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo
sapiens GN=CHAF1B PE=1 SV=1
Length = 559

Score = 30.8 bits (68), Expect = 2.2
Identities = 16/36 (44%), Positives = 20/36 (55%)
Frame = +1

Query: 121 SRRETPSLV*TSPSQALNATAPTCIHDVPFTLPRLQ 228
SR + PS T+P QA A APT I D P P ++
Sbjct: 422 SRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVK 457


>sp|O83823|Y851_TREPA Uncharacterized protein TP_0851 OS=Treponema
pallidum GN=TP_0851 PE=1 SV=1
Length = 724

Score = 30.4 bits (67), Expect = 2.9
Identities = 24/77 (31%), Positives = 35/77 (45%)
Frame = +1

Query: 61 HIAPTYKTLASEFEHQVSWHSRRETPSLV*TSPSQALNATAPTCIHDVPFTLPRLQCTEH 240
HI Y LA+ +E + H+ SL T L T H + T+ + + T+
Sbjct: 609 HIHKEYDALAATYETDKALHAYAVLCSLARTRIDAPLLCTYVQ--HAI--TIEKYRVTQ- 663

Query: 241 THRLRCKDLLKPIRHIS 291
H+ RCKD L P R I+
Sbjct: 664 IHKTRCKDYLNPFREIT 680


>sp|O84000|Y1037_TREPA UPF0073 membrane protein TP_1037 OS=Treponema
pallidum GN=TP_1037 PE=3 SV=1
Length = 238

Score = 30.0 bits (66), Expect = 3.8
Identities = 13/44 (29%), Positives = 24/44 (54%)
Frame = -2

Query: 294 GTYVSDRLQQVFAAQSVRVFGALKPRECEGNIVYAGWGRCIQCL 163
GTY + L ++ A VFG + C G+++Y+ +G ++ L
Sbjct: 119 GTYTASCLTTLYGAIGWTVFGVIWGLACSGSVIYSVFGHRVRWL 162


>sp|Q92M99|GLMM_RHIME Phosphoglucosamine mutase OS=Rhizobium
meliloti GN=glmM PE=3 SV=1
Length = 450

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
Frame = +3

Query: 138 KLGINITFTGTECNGPNLHTRCSLHTPSA---SVHRTHAQIALQRLVEAD 278
+LG + GTE NG N++ C P+A VH A I + +AD
Sbjct: 198 ELGAEVVTIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGIALDGDAD 247


>sp|P79926|HNF4B_XENLA Hepatocyte nuclear factor 4-beta OS=Xenopus
laevis GN=hnf4b PE=2 SV=1
Length = 446

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/62 (27%), Positives = 30/62 (48%)
Frame = -1

Query: 229 TEAEGV*REHRVCRLGPLHSVPVKVMFIPSLGSLCESATRPGVRTPRLAFCRSVLYVKAF 50
T+AE + H+ + P+HS + + + S+ +CES ++ L Y+ AF
Sbjct: 146 TQAEAM--VHQYSPVSPVHSSDISMKKVASISDVCES-----MKQQLLLLVEWAKYIPAF 198

Query: 49 CE 44
CE
Sbjct: 199 CE 200


>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3
OS=Homo sapiens GN=CELSR3 PE=1 SV=1
Length = 3312

Score = 29.6 bits (65), Expect = 4.9
Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%)
Frame = -2

Query: 306 EFEDGTYVSDRLQQVF--AAQSVRVFGALKPRECEGNIVYAGWGRCIQCL*R*CLYQAWG 133
E ED R Q+ AAQS R+ P++ +GN + + W +C C Q WG
Sbjct: 2912 ESEDNGRTRGRFQRPLCRAAQSERLL--THPKDVDGNDLLSYWPALGECEAAPCALQTWG 2969

Query: 132 LSARVPRD 109
R+ D
Sbjct: 2970 SERRLGLD 2977


>sp|A6UCS2|GLMM_SINMW Phosphoglucosamine mutase OS=Sinorhizobium
medicae (strain WSM419) GN=glmM PE=3 SV=1
Length = 451

Score = 29.3 bits (64), Expect = 6.4
Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
Frame = +3

Query: 138 KLGINITFTGTECNGPNLHTRCSLHTPSA---SVHRTHAQIALQRLVEAD 278
+LG + GTE NG N++ C P+A VH A I + +AD
Sbjct: 198 ELGAEVVPIGTEPNGVNINLECGSTHPAALQKKVHEVRADIGIALDGDAD 247


>sp|B0YPN0|MATK_ANEMR Maturase K OS=Aneura mirabilis GN=matK PE=3
SV=1
Length = 510

Score = 28.9 bits (63), Expect = 8.4
Identities = 18/52 (34%), Positives = 27/52 (51%)
Frame = +1

Query: 154 SPSQALNATAPTCIHDVPFTLPRLQCTEHTHRLRCKDLLKPIRHISAIFELP 309
+PS L+ T P C+H P L R+ C +H + LL+ + H S F +P
Sbjct: 147 NPSNYLDITIPHCVH--PEILIRI-CRKHILDISFLHLLRLMLHTSNHFRIP 195


tr_hit_id B7D5S1
Definition tr|B7D5S1|B7D5S1_9BURK Putative uncharacterized protein OS=Diaphorobacter sp. TPSY
Align length 83
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920343|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_A05.
(334 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7D5S1|B7D5S1_9BURK Putative uncharacterized protein OS=Diaph... 34 4.2
tr|Q9KY94|Q9KY94_STRCO Putative septum site-determining protein ... 33 5.5
tr|B0A7D9|B0A7D9_9CLOT Putative uncharacterized protein OS=Clost... 33 7.2
tr|A9USV1|A9USV1_MONBE Predicted protein OS=Monosiga brevicollis... 33 9.4

>tr|B7D5S1|B7D5S1_9BURK Putative uncharacterized protein
OS=Diaphorobacter sp. TPSY GN=DtpsyDRAFT_1834 PE=4 SV=1
Length = 114

Score = 33.9 bits (76), Expect = 4.2
Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
Frame = +2

Query: 89 PRSSNTRSRGTLAERPQAWYKHHLHRH*MQRPQPAYTMFPSHSLGFSAPNTRTDC-AAKT 265
PR+S T +RG +ER W HHL R M P P +A NT +A +
Sbjct: 2 PRNSCTDTRGIFSERTVRWRCHHLRR--MNTPSP------------TASNTNPPWPSAVS 47

Query: 266 C*SRSDT*VPSSNSLSINAPTHV 334
SRS T V +S+ + PT +
Sbjct: 48 TASRSSTVVLNSDPSNTAEPTQI 70


>tr|Q9KY94|Q9KY94_STRCO Putative septum site-determining protein
OS=Streptomyces coelicolor GN=SCO5008 PE=4 SV=1
Length = 131

Score = 33.5 bits (75), Expect = 5.5
Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (4%)
Frame = -3

Query: 206 GTSCMQVGAVAFSACEGDVYTKLGV---SLRECHETWCSNSEASVL*VGAICQSLL*RDE 36
G + +Q+G +A++A + + G SLRE ET C+ + +S L G C + DE
Sbjct: 41 GMAAVQLGLIAYTAQQAGTAARAGARSASLRESAETACAAAVSSWLADGTDCPASYGGDE 100

Query: 35 VLQSAT 18
V +AT
Sbjct: 101 VTVTAT 106


>tr|B0A7D9|B0A7D9_9CLOT Putative uncharacterized protein
OS=Clostridium bartlettii DSM 16795 GN=CLOBAR_00377 PE=4
SV=1
Length = 391

Score = 33.1 bits (74), Expect = 7.2
Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 6/79 (7%)
Frame = +3

Query: 81 NASLGVRTPGLVALSQRDPKL----GINITFTGTECNGPNLHTRCSLHTPSASVHRTHAQ 248
+ S G GL + +D + G IT TG +G H A VH
Sbjct: 159 HVSAGKMPVGLYMYNSKDTMMFSVDGFKITLTGKGSHGAYPHAGVDPINIGAHVH----- 213

Query: 249 IALQRLV--EADPTHKCHL 299
+ALQ L+ E+DPTH C L
Sbjct: 214 LALQELIARESDPTHSCVL 232


>tr|A9USV1|A9USV1_MONBE Predicted protein OS=Monosiga brevicollis
GN=5915 PE=4 SV=1
Length = 765

Score = 32.7 bits (73), Expect = 9.4
Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 5/101 (4%)
Frame = +3

Query: 39 VSSQKALTYSTDLQNASLGV----RTPGLVALSQRDPKLGI-NITFTGTECNGPNLHTRC 203
++S Y L N +L + P +AL+++ I ++T G C P LH
Sbjct: 49 IASPPVAAYPQSLVNTTLQLVCLLYDPDALALAEQLLLKWIPDVTTAGLLCRLPILH--- 105

Query: 204 SLHTPSASVHRTHAQIALQRLVEADPTHKCHLRTPLASMHP 326
LHT + S H AQ A+ L +HK RT L ++ P
Sbjct: 106 ELHTCTQSPHAPSAQAAIHILSSVACSHKSLARTLLLTLGP 146