BP920359
Clone id YMU001_000136_B11
Library
Length 466
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_B11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGTTAAACAAGCAAAGACCATCTGGCACTCCCACCAAGTCAAGTTCCATCAAGCATCTT
CAATTGCTTCCGTATGAGCTGATTTGGAACAATGTTATCAGCTCGTAACCTATCTAAAAA
CCCATACGGACTCATCGCCCCATTCTCATAGGCCTTCAACAAGACAATGTATGATCTGTA
TGCACATGAATATCCAGCGCTTTTCAAATCTTTAATCACCTTCTCTGCTCTCTTCACGTC
CCCTTTTTCAGCACACCAATCTAATATAGCCTGATAAGTAGAGTACATTGGCCTCTTCCT
GATCGATGTTTGACTAGCTTTTTGGGCTATGGAAAGAACCTCCATTGCTTTGTGCTCTTG
GCCAGCCTTCAAATACATGAGTACCAGCTCATGATATGTCAAAGAATTAGCATGCAATCT
TGCTTTTGCTAATTGTTTCAGCAGACTCTCTCCTTTCTGTGTCCTC
■■Homology search results ■■ -
sp_hit_id Q9LRP6
Definition sp|Q9LRP6|PP234_ARATH Pentatricopeptide repeat-containing protein At3g15590, mitochondrial OS=Arabidopsis thaliana
Align length 136
Score (bit) 96.3
E-value 6.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920359|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_B11.
(466 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LRP6|PP234_ARATH Pentatricopeptide repeat-containing protei... 96 6e-20
sp|Q9C977|PP135_ARATH Pentatricopeptide repeat-containing protei... 90 4e-18
sp|Q9XI21|PPR44_ARATH Pentatricopeptide repeat-containing protei... 86 8e-17
sp|Q940Q2|PPR19_ARATH Pentatricopeptide repeat-containing protei... 49 1e-05
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protei... 48 2e-05
sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protei... 45 2e-04
sp|Q9M8W9|PP211_ARATH Pentatricopeptide repeat-containing protei... 44 3e-04
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protei... 44 5e-04
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protei... 43 6e-04
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protei... 43 8e-04
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protei... 43 8e-04
sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protei... 42 0.001
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 42 0.001
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protei... 41 0.002
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protei... 41 0.002
sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protei... 40 0.005
sp|Q9SY07|PP302_ARATH Pentatricopeptide repeat-containing protei... 40 0.007
sp|Q28C74|LPPRC_XENTR Leucine-rich PPR motif-containing protein,... 40 0.007
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protei... 39 0.009
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protei... 39 0.011
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protei... 39 0.011
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protei... 39 0.015
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protei... 39 0.015
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protei... 38 0.019
sp|Q9LPC4|PPR1_ARATH Pentatricopeptide repeat-containing protein... 38 0.025
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protei... 38 0.025
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protei... 37 0.033
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protei... 37 0.033
sp|Q3ECH5|PP107_ARATH Pentatricopeptide repeat-containing protei... 37 0.033

>sp|Q9LRP6|PP234_ARATH Pentatricopeptide repeat-containing protein
At3g15590, mitochondrial OS=Arabidopsis thaliana
GN=At3g15590 PE=2 SV=1
Length = 610

Score = 96.3 bits (238), Expect = 6e-20
Identities = 50/136 (36%), Positives = 80/136 (58%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG L+K++ A + T+H LV +Y+KAG+ KA +L+ A K + + RPM++T
Sbjct: 466 KGRDLVKRMGNAGIAIGPSTWHALVKLYIKAGEVGKAELILNRATKDN----KMRPMFTT 521

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y AIL+ A++GDV EKV +K A Y+ Y +L AY N YG ++R++AD
Sbjct: 522 YMAILEEYAKRGDVHNTEKVFMKMKRASYAAQLMQYETVLLAYINAKTPAYGMIERMKAD 581

Query: 96 NIVPNQLIRKQLKMLD 49
N+ PN+ + +L ++
Sbjct: 582 NVFPNKSLAAKLAQVN 597



Score = 30.8 bits (68), Expect = 3.1
Identities = 20/103 (19%), Positives = 48/103 (46%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
K E + ++ + + + ++L+L+Y ++ K +VL + ++ + +P +T
Sbjct: 260 KAEDIFNKMKELKFPTSVFACNQLLLLYSMHDRK-KISDVLLLMERENI-----KPSRAT 313

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAY 148
Y +++ GD+ EK+++ +K G +L K Y
Sbjct: 314 YHFLINSKGLAGDITGMEKIVETIKEEGIELDPELQSILAKYY 356


>sp|Q9C977|PP135_ARATH Pentatricopeptide repeat-containing protein
At1g80270, mitochondrial OS=Arabidopsis thaliana
GN=At1g80270 PE=2 SV=1
Length = 596

Score = 90.1 bits (222), Expect = 4e-18
Identities = 47/136 (34%), Positives = 79/136 (58%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L+K++A++ + T+ L+ +Y++AG+ KA +L A K S T + M ++
Sbjct: 453 KGKDLVKRMAESGCRIEATTWDALIKLYVEAGEVEKADSLLDKASKQSHTKL----MMNS 508

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
+ I+D +++GDV EK+ ++ AGY+ R + L++AY N YG DRL+AD
Sbjct: 509 FMYIMDEYSKRGDVHNTEKIFLKMREAGYTSRLRQFQALMQAYINAKSPAYGMRDRLKAD 568

Query: 96 NIVPNQLIRKQLKMLD 49
NI PN+ + QL D
Sbjct: 569 NIFPNKSMAAQLAQGD 584


>sp|Q9XI21|PPR44_ARATH Pentatricopeptide repeat-containing protein
At1g15480, mitochondrial OS=Arabidopsis thaliana
GN=At1g15480 PE=2 SV=2
Length = 594

Score = 85.9 bits (211), Expect = 8e-17
Identities = 43/136 (31%), Positives = 79/136 (58%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
+G+ L+KQ++ + + +LT+ ++ +Y++AG+ KA LS A ++ Q +P+ S+
Sbjct: 451 EGKDLVKQMSDSGCNIGALTWDAVIKLYVEAGEVEKAESSLSKAIQSKQI----KPLMSS 506

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
+ ++ +GDV EK+ + +K AGY + +Y L++AY N YG +R++AD
Sbjct: 507 FMYLMHEYVRRGDVHNTEKIFQRMKQAGYQSRFWAYQTLIQAYVNAKAPAYGMKERMKAD 566

Query: 96 NIVPNQLIRKQLKMLD 49
NI PN+ + QL D
Sbjct: 567 NIFPNKRLAAQLAKAD 582


>sp|Q940Q2|PPR19_ARATH Pentatricopeptide repeat-containing protein
At1g07590, mitochondrial OS=Arabidopsis thaliana
GN=At1g07590 PE=2 SV=1
Length = 534

Score = 48.5 bits (114), Expect = 1e-05
Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 2/139 (1%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQ--KASQTSIRKRPM 286
+K + +++ NS+TY L L KA +A++ + + K S++ P
Sbjct: 392 EKAIGVFREMTGNGFKPNSITYRHLALGCAKAKLMKEALKNIEMGLNLKTSKSIGSSTPW 451

Query: 285 YSTYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRL 106
T +I++ AEKGDV+ +EK+ +++K+A Y+ Y L KAY + R+
Sbjct: 452 LETTLSIIECFAEKGDVENSEKLFEEVKNAKYNRYAFVYNALFKAYVKAKVYDPNLFKRM 511

Query: 105 RADNIVPNQLIRKQLKMLD 49
P+ LK+++
Sbjct: 512 VLGGARPDAESYSLLKLVE 530


>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein
At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1
Length = 822

Score = 47.8 bits (112), Expect = 2e-05
Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 2/115 (1%)
Frame = -2

Query: 399 TYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQAILDWCAEKGDVKRAEK 220
T++ L+ Y + G E A ++ +A + +TY A+L+ A KGD + E
Sbjct: 493 TFNTLISAYGRCGSEVDASKMYGEMTRAGFNAC-----VTTYNALLNALARKGDWRSGEN 547

Query: 219 VIKDLKSAGYSCAYRSYIVLLKAYENGA--MSPYGFLDRLRADNIVPNQLIRKQL 61
VI D+KS G+ SY ++L+ Y G + +R++ I P+ ++ + L
Sbjct: 548 VISDMKSKGFKPTETSYSLMLQCYAKGGNYLGIERIENRIKEGQIFPSWMLLRTL 602



Score = 45.1 bits (105), Expect = 2e-04
Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
Frame = -2

Query: 447 SLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQA 268
S+LK++ + A+S+TY+ELV Y++AG +A V+ + K P TY
Sbjct: 337 SVLKEMEENSCPADSVTYNELVAAYVRAGFSKEAAGVIEMMTKKG-----VMPNAITYTT 391

Query: 267 ILDWCAEKGDVKRAEKVIKDLKSAG---YSCAYRSYIVLL 157
++D + G A K+ +K AG +C Y + + LL
Sbjct: 392 VIDAYGKAGKEDEALKLFYSMKEAGCVPNTCTYNAVLSLL 431



Score = 40.4 bits (93), Expect = 0.004
Identities = 38/173 (21%), Positives = 73/173 (42%), Gaps = 41/173 (23%)
Frame = -2

Query: 462 TQKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAME------------------- 340
+++ +++ + K + N++TY ++ Y KAG+E +A++
Sbjct: 367 SKEAAGVIEMMTKKGVMPNAITYTTVIDAYGKAGKEDEALKLFYSMKEAGCVPNTCTYNA 426

Query: 339 VLSIAQKASQTSIRKR-----------PMYSTYQAILDWCAEKGDVKRAEKVIKDLKSAG 193
VLS+ K S+++ + P +T+ +L C KG K +V +++KS G
Sbjct: 427 VLSLLGKKSRSNEMIKMLCDMKSNGCSPNRATWNTMLALCGNKGMDKFVNRVFREMKSCG 486

Query: 192 YSCAYRSYIVLLKAYEN-----------GAMSPYGFLDRLRADNIVPNQLIRK 67
+ ++ L+ AY G M+ GF + N + N L RK
Sbjct: 487 FEPDRDTFNTLISAYGRCGSEVDASKMYGEMTRAGFNACVTTYNALLNALARK 539



Score = 38.1 bits (87), Expect = 0.019
Identities = 21/103 (20%), Positives = 51/103 (49%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
+ E +L+ + + L + +TY+ L+ MY++ G+ KA E+L +K+ + +P +
Sbjct: 649 QAEGILESIREDGLSPDLVTYNSLMDMYVRRGECWKAEEILKTLEKS-----QLKPDLVS 703

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAY 148
Y ++ +G ++ A +++ ++ G +Y + Y
Sbjct: 704 YNTVIKGFCRRGLMQEAVRMLSEMTERGIRPCIFTYNTFVSGY 746



Score = 32.0 bits (71), Expect = 1.4
Identities = 21/104 (20%), Positives = 50/104 (48%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYS 280
+K L +++ + +TY+ ++ ++ K G+ + ++L + + ++
Sbjct: 227 EKAIDLFERMKEMGPSPTLVTYNVILDVFGKMGRSWR--KILGVLDEMRSKGLKFDEF-- 282

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAY 148
T +L CA +G ++ A++ +LKS GY +Y LL+ +
Sbjct: 283 TCSTVLSACAREGLLREAKEFFAELKSCGYEPGTVTYNALLQVF 326


>sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protein
At4g30825, chloroplastic OS=Arabidopsis thaliana
GN=At4g30825 PE=2 SV=2
Length = 904

Score = 45.1 bits (105), Expect = 2e-04
Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
Frame = -2

Query: 396 YHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQAILDWCAEKGDVKRAEKV 217
Y+ L+ Y K Q K +L +K++ P + TY +++ E+G + V
Sbjct: 771 YNTLLDAYGKDKQMEKFRSILKRMKKSTSG-----PDHYTYNIMINIYGEQGWIDEVADV 825

Query: 216 IKDLKSAGYSCAYRSYIVLLKAYENGAM--SPYGFLDRLRADNIVPNQL 76
+K+LK +G SY L+KAY G M G + +R NI+P+++
Sbjct: 826 LKELKESGLGPDLCSYNTLIKAYGIGGMVEEAVGLVKEMRGRNIIPDKV 874


>sp|Q9M8W9|PP211_ARATH Pentatricopeptide repeat-containing protein
At3g04130, mitochondrial OS=Arabidopsis thaliana
GN=At3g04130 PE=2 SV=2
Length = 508

Score = 43.9 bits (102), Expect = 3e-04
Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
Frame = -2

Query: 465 RTQKGESLLK-QLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRP 289
R ++ E + + ++ + + N+ TY+ ++ MY +E KA+E+L K ++S P
Sbjct: 344 RLEEAERVFRVEMPELGVSINTSTYNSMIAMYCHHDEEDKAIELL----KEMESSNLCNP 399

Query: 288 MYSTYQAILDWCAEKGDVKRAEKVIKDL 205
TYQ +L C ++GDV K++K++
Sbjct: 400 DVHTYQPLLRSCFKRGDVVEVGKLLKEM 427


>sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein
At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2
Length = 1096

Score = 43.5 bits (101), Expect = 5e-04
Identities = 29/103 (28%), Positives = 52/103 (50%)
Frame = -2

Query: 465 RTQKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPM 286
R KG LL+ + K +H N +TY+ L+ + G+ A ++L+ S P
Sbjct: 278 RIAKGYLLLRDMRKRMIHPNEVTYNTLINGFSNEGKVLIASQLLN-----EMLSFGLSPN 332

Query: 285 YSTYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLL 157
+ T+ A++D +G+ K A K+ +++ G + + SY VLL
Sbjct: 333 HVTFNALIDGHISEGNFKEALKMFYMMEAKGLTPSEVSYGVLL 375



Score = 40.8 bits (94), Expect = 0.003
Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 2/126 (1%)
Frame = -2

Query: 447 SLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQA 268
S LK++ K ++ + T++ L+ + G K+ ++ +K+ P TY
Sbjct: 179 SFLKEMLKRKICPDVATFNILINVLCAEGSFEKSSYLMQKMEKSGYA-----PTIVTYNT 233

Query: 267 ILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLK--AYENGAMSPYGFLDRLRADN 94
+L W +KG K A +++ +KS G +Y +L+ N Y L +R
Sbjct: 234 VLHWYCKKGRFKAAIELLDHMKSKGVDADVCTYNMLIHDLCRSNRIAKGYLLLRDMRKRM 293

Query: 93 IVPNQL 76
I PN++
Sbjct: 294 IHPNEV 299


>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein
At5g42310, mitochondrial OS=Arabidopsis thaliana
GN=At5g42310 PE=2 SV=1
Length = 709

Score = 43.1 bits (100), Expect = 6e-04
Identities = 24/99 (24%), Positives = 52/99 (52%)
Frame = -2

Query: 444 LLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQAI 265
L K++ + +L + +++++ + K+G KA+++L +AQ ++ +T +I
Sbjct: 256 LYKEIERDKLELDVQLVNDIIMGFAKSGDPSKALQLLGMAQATGLSA-----KTATLVSI 310

Query: 264 LDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAY 148
+ A+ G AE + ++L+ +G R+Y LLK Y
Sbjct: 311 ISALADSGRTLEAEALFEELRQSGIKPRTRAYNALLKGY 349



Score = 36.2 bits (82), Expect = 0.073
Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
Frame = -2

Query: 414 HANSLTYHELVLMYLKA-GQEHKAMEVLSIAQKASQTSIRKRPMYSTYQAILDWCAEKGD 238
H +Y L + + A G+ K E ++QK + T + TY A++ CA D
Sbjct: 160 HNLCFSYELLYSILIHALGRSEKLYEAFLLSQKQTLTPL-------TYNALIGACARNND 212

Query: 237 VKRAEKVIKDLKSAGYSCAYRSYIVLLKA 151
+++A +I ++ GY + +Y +++++
Sbjct: 213 IEKALNLIAKMRQDGYQSDFVNYSLVIQS 241


>sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein
At1g13040, mitochondrial OS=Arabidopsis thaliana
GN=At1g13040 PE=2 SV=1
Length = 517

Score = 42.7 bits (99), Expect = 8e-04
Identities = 28/101 (27%), Positives = 52/101 (51%)
Frame = -2

Query: 450 ESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYSTYQ 271
E + +++ AR+ +++ Y+ L+ + KAG+ KA A K+ + I P TY
Sbjct: 205 EMVAEEIKSARVKLSTVVYNALISGFCKAGRIEKAE-----ALKSYMSKIGCEPDLVTYN 259

Query: 270 AILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAY 148
+L++ + +KRAE V+ ++ +G SY LLK +
Sbjct: 260 VLLNYYYDNNMLKRAEGVMAEMVRSGIQLDAYSYNQLLKRH 300


tr_hit_id A7QJH1
Definition tr|A7QJH1|A7QJH1_VITVI Chromosome chr8 scaffold_106, whole genome shotgun sequence OS=Vitis vinifera
Align length 136
Score (bit) 100.0
E-value 3.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920359|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_B11.
(466 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QJH1|A7QJH1_VITVI Chromosome chr8 scaffold_106, whole genom... 100 3e-20
tr|B4FKG3|B4FKG3_MAIZE Putative uncharacterized protein OS=Zea m... 90 5e-17
tr|Q2QX42|Q2QX42_ORYSJ Os12g0170100 protein OS=Oryza sativa subs... 88 2e-16
tr|A2ZIH5|A2ZIH5_ORYSI Putative uncharacterized protein OS=Oryza... 88 2e-16
tr|Q9MQV2|Q9MQV2_WHEAT DNA-binding protein OS=Triticum aestivum ... 87 3e-16
tr|B6ST71|B6ST71_MAIZE DNA-binding protein OS=Zea mays PE=2 SV=1 87 3e-16
tr|Q7F7G0|Q7F7G0_ORYSJ Putative DNA-binding protein OS=Oryza sat... 86 7e-16
tr|Q5NAB7|Q5NAB7_ORYSJ Putative DNA-binding protein (Putative un... 86 7e-16
tr|A2WNI1|A2WNI1_ORYSI Putative uncharacterized protein OS=Oryza... 86 7e-16
tr|A9TZ88|A9TZ88_PHYPA Predicted protein (Fragment) OS=Physcomit... 84 3e-15
tr|A9RNS7|A9RNS7_PHYPA Predicted protein OS=Physcomitrella paten... 80 7e-14
tr|Q7EYW9|Q7EYW9_ORYSJ Os07g0222700 protein OS=Oryza sativa subs... 75 2e-12
tr|A3BHV9|A3BHV9_ORYSJ Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|A2YJI4|A2YJI4_ORYSI Putative uncharacterized protein OS=Oryza... 75 2e-12
tr|B8LLC6|B8LLC6_PICSI Putative uncharacterized protein OS=Picea... 74 3e-12
tr|A7NZ05|A7NZ05_VITVI Chromosome chr6 scaffold_3, whole genome ... 59 9e-08
tr|Q2HUF5|Q2HUF5_MEDTR Tetratricopeptide-like helical OS=Medicag... 55 2e-06
tr|Q2RBQ4|Q2RBQ4_ORYSJ Os11g0103000 protein OS=Oryza sativa subs... 52 1e-05
tr|Q2QYY1|Q2QYY1_ORYSJ Pentatricopeptide, putative, expressed OS... 52 1e-05
tr|Q0IQS7|Q0IQS7_ORYSJ Os12g0102600 protein (Fragment) OS=Oryza ... 52 1e-05
tr|A3CE34|A3CE34_ORYSJ Putative uncharacterized protein OS=Oryza... 52 1e-05
tr|A2ZH63|A2ZH63_ORYSI Putative uncharacterized protein OS=Oryza... 52 1e-05
tr|Q6H7X0|Q6H7X0_ORYSJ Os02g0170000 protein OS=Oryza sativa subs... 50 4e-05
tr|B8AII6|B8AII6_ORYSI Putative uncharacterized protein OS=Oryza... 50 4e-05
tr|A3A3K8|A3A3K8_ORYSJ Putative uncharacterized protein OS=Oryza... 50 4e-05
tr|A3BPW9|A3BPW9_ORYSJ Putative uncharacterized protein OS=Oryza... 50 6e-05
tr|A9SEH7|A9SEH7_PHYPA Predicted protein OS=Physcomitrella paten... 49 1e-04
tr|B6U1C3|B6U1C3_MAIZE Putative uncharacterized protein OS=Zea m... 49 2e-04
tr|A9NXP3|A9NXP3_PICSI Putative uncharacterized protein OS=Picea... 48 2e-04
tr|A7Q6B7|A7Q6B7_VITVI Chromosome chr11 scaffold_56, whole genom... 48 2e-04

>tr|A7QJH1|A7QJH1_VITVI Chromosome chr8 scaffold_106, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000637001
PE=4 SV=1
Length = 611

Score = 100 bits (250), Expect = 3e-20
Identities = 53/136 (38%), Positives = 85/136 (62%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L+KQ++ + LT+ LV +Y++AG+ KA ++L QKA Q S K PM+ST
Sbjct: 468 KGKDLVKQMSDSGCRIGPLTWDALVKLYVEAGEVEKADKIL---QKAMQQSPIK-PMFST 523

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y AI+D A++GD+ +EK+ ++ +GY R + L++AY N YG +R++AD
Sbjct: 524 YMAIMDQYAKRGDIHNSEKMFHQMRQSGYVSRLRQFQCLIQAYVNAKAPAYGIKERMKAD 583

Query: 96 NIVPNQLIRKQLKMLD 49
NI PN+++ QL +D
Sbjct: 584 NIFPNRVVAGQLAQVD 599


>tr|B4FKG3|B4FKG3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 172

Score = 90.1 bits (222), Expect = 5e-17
Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 1/137 (0%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKAS-QTSIRKRPMYS 280
KG+ L K++ + R+ + T LV +Y++AG+ KA S+ K S Q I+ P+Y+
Sbjct: 28 KGKELAKRMDENRVRFGAPTLDALVKLYVEAGEVEKAE---SLVHKLSIQNHIK--PIYN 82

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRA 100
TY +LD ++KGDV+ +EKV L+ +GY+ R Y VLL AY YGF +R++A
Sbjct: 83 TYMTLLDSYSKKGDVRNSEKVFNKLRQSGYTGRIRMYQVLLHAYVRAKAPAYGFRERMKA 142

Query: 99 DNIVPNQLIRKQLKMLD 49
DNI PN ++ + D
Sbjct: 143 DNIFPNSVVSTLIAATD 159


>tr|Q2QX42|Q2QX42_ORYSJ Os12g0170100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0170100 PE=2 SV=1
Length = 611

Score = 87.8 bits (216), Expect = 2e-16
Identities = 50/136 (36%), Positives = 75/136 (55%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L K++ T LV +Y AG+ KA +L K S + + +PMY+T
Sbjct: 467 KGKELAKRMGDDGCRLGPYTLDSLVKLYSDAGEVEKADSIL---HKLSYKN-KIKPMYTT 522

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y +LD ++KGDV AEK+ ++ GY+ R Y +LL+AY N PYGF +R++AD
Sbjct: 523 YLMLLDSYSKKGDVHNAEKLFSKVRQMGYTGRIRQYQLLLEAYLNAKTPPYGFKERMKAD 582

Query: 96 NIVPNQLIRKQLKMLD 49
+I PN+ + L D
Sbjct: 583 DIFPNRAVASLLAATD 598


>tr|A2ZIH5|A2ZIH5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37623 PE=4 SV=1
Length = 611

Score = 87.8 bits (216), Expect = 2e-16
Identities = 50/136 (36%), Positives = 75/136 (55%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L K++ T LV +Y AG+ KA +L K S + + +PMY+T
Sbjct: 467 KGKELAKRMGDDGCRLGPYTLDSLVKLYSDAGEVEKADSIL---HKLSYKN-KIKPMYTT 522

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y +LD ++KGDV AEK+ ++ GY+ R Y +LL+AY N PYGF +R++AD
Sbjct: 523 YLMLLDSYSKKGDVHNAEKLFSKVRQMGYTGRIRQYQLLLEAYLNAKTPPYGFKERMKAD 582

Query: 96 NIVPNQLIRKQLKMLD 49
+I PN+ + L D
Sbjct: 583 DIFPNRAVASLLAATD 598


>tr|Q9MQV2|Q9MQV2_WHEAT DNA-binding protein OS=Triticum aestivum
PE=2 SV=1
Length = 612

Score = 87.4 bits (215), Expect = 3e-16
Identities = 48/137 (35%), Positives = 75/137 (54%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYS 280
+KG+ L K++ + T LV +Y+ AG+ KA +L K++ + +P YS
Sbjct: 468 KKGKELAKRMDEDGCRLGISTIDSLVKLYVGAGEVDKAESILHKLSKSN----KMKPQYS 523

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRA 100
+Y +LD ++KGD+ +EKV L+ GY+ R Y +LL AY + YGF +R++A
Sbjct: 524 SYLMLLDTYSKKGDIHNSEKVFDQLRQMGYNGRVRQYQLLLNAYVHAKTPVYGFRERMKA 583

Query: 99 DNIVPNQLIRKQLKMLD 49
DNI PN +I L D
Sbjct: 584 DNIFPNSVIASLLAATD 600


>tr|B6ST71|B6ST71_MAIZE DNA-binding protein OS=Zea mays PE=2 SV=1
Length = 622

Score = 87.4 bits (215), Expect = 3e-16
Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 1/137 (0%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKAS-QTSIRKRPMYS 280
KG+ L K++ + R+ + T LV +Y++AG+ KA S+ K S Q I+ P+Y+
Sbjct: 478 KGKELAKRMDENRVRFGAPTLDALVKLYVEAGEVEKAE---SLVHKLSIQNHIK--PIYN 532

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRA 100
TY +LD ++KGDV+ +EKV L+ +GY+ R Y LL AY + YGF +R++A
Sbjct: 533 TYMTLLDSYSKKGDVRNSEKVFNKLRQSGYTGRIRMYQSLLHAYVHAKAPAYGFRERMKA 592

Query: 99 DNIVPNQLIRKQLKMLD 49
DNI PN + + D
Sbjct: 593 DNIFPNSAVSTLIAATD 609



Score = 34.3 bits (77), Expect = 3.2
Identities = 19/86 (22%), Positives = 45/86 (52%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYS 280
+K E + ++ ++++L+L+Y + ++ K +VL++ +K +P
Sbjct: 271 KKSEQVFNRMKDLGFPVTQFSFNQLLLLYKRLDRK-KIADVLAMMEKEDV-----KPSLF 324

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLK 202
TY+ ++D GD++ EKVI+ ++
Sbjct: 325 TYKILVDAKGSVGDIEAMEKVIESME 350


>tr|Q7F7G0|Q7F7G0_ORYSJ Putative DNA-binding protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0036E02.13 PE=4 SV=1
Length = 591

Score = 86.3 bits (212), Expect = 7e-16
Identities = 49/136 (36%), Positives = 75/136 (55%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L K++ T LV +Y AG+ KA +L K S + + +P+Y+T
Sbjct: 447 KGKELAKRMGDDGCRLGPSTLDSLVKLYSDAGEVEKADSIL---HKLSYKN-KIKPLYTT 502

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y +LD ++KGDV AEK+ ++ GY+ R Y +LL+AY N PYGF +R++AD
Sbjct: 503 YLMLLDSYSKKGDVHNAEKLFSKVRQMGYTGRIRQYQLLLEAYLNAKTPPYGFKERMKAD 562

Query: 96 NIVPNQLIRKQLKMLD 49
+I PN+ + L D
Sbjct: 563 DIFPNRAVASLLAATD 578


>tr|Q5NAB7|Q5NAB7_ORYSJ Putative DNA-binding protein (Putative
uncharacterized protein) (Os01g0280400 protein) OS=Oryza
sativa subsp. japonica GN=B1085F09.11 PE=4 SV=1
Length = 611

Score = 86.3 bits (212), Expect = 7e-16
Identities = 49/136 (36%), Positives = 75/136 (55%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L K++ T LV +Y AG+ KA +L K S + + +P+Y+T
Sbjct: 467 KGKELAKRMGDDGCRLGPSTLDSLVKLYSDAGEVEKADSIL---HKLSYKN-KIKPLYTT 522

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y +LD ++KGDV AEK+ ++ GY+ R Y +LL+AY N PYGF +R++AD
Sbjct: 523 YLMLLDSYSKKGDVHNAEKLFSKVRQMGYTGRIRQYQLLLEAYLNAKTPPYGFKERMKAD 582

Query: 96 NIVPNQLIRKQLKMLD 49
+I PN+ + L D
Sbjct: 583 DIFPNRAVASLLAATD 598


>tr|A2WNI1|A2WNI1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_01409 PE=4 SV=1
Length = 611

Score = 86.3 bits (212), Expect = 7e-16
Identities = 49/136 (36%), Positives = 75/136 (55%)
Frame = -2

Query: 456 KGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYST 277
KG+ L K++ T LV +Y AG+ KA +L K S + + +P+Y+T
Sbjct: 467 KGKELAKRMGDDGCRLGPSTLDSLVKLYSDAGEVEKADSIL---HKLSYKN-KIKPLYTT 522

Query: 276 YQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRAD 97
Y +LD ++KGDV AEK+ ++ GY+ R Y +LL+AY N PYGF +R++AD
Sbjct: 523 YLMLLDSYSKKGDVHNAEKLFSKVRQMGYTGRIRQYQLLLEAYLNAKTPPYGFKERMKAD 582

Query: 96 NIVPNQLIRKQLKMLD 49
+I PN+ + L D
Sbjct: 583 DIFPNRAVASLLAATD 598


>tr|A9TZ88|A9TZ88_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_31533 PE=4 SV=1
Length = 448

Score = 84.3 bits (207), Expect = 3e-15
Identities = 51/127 (40%), Positives = 71/127 (55%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYS 280
+K E L++ + K N++TYH LV YLK Q KA+ V+ AQ S+ R R
Sbjct: 317 EKAEKLVEDMVKLGRKKNAVTYHHLVTGYLKTDQLDKALAVMKEAQGDSKQG-RSRLWVE 375

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKSAGYSCAYRSYIVLLKAYENGAMSPYGFLDRLRA 100
T ++LD AE+GDV AEK +D+K A + Y +LLKAY + GFL R+ A
Sbjct: 376 TLISVLDAYAERGDVISAEKQFQDIKKAYPRPNIQVYNILLKAYIKSRVPALGFLQRMLA 435

Query: 99 DNIVPNQ 79
D +VPN+
Sbjct: 436 DKLVPNE 442



Score = 38.9 bits (89), Expect = 0.13
Identities = 22/87 (25%), Positives = 48/87 (55%)
Frame = -2

Query: 459 QKGESLLKQLAKARLHANSLTYHELVLMYLKAGQEHKAMEVLSIAQKASQTSIRKRPMYS 280
QK ++LL++L + +++++L+Y + G +K E+L+ +T + +Y
Sbjct: 107 QKADALLEKLKGTGILTLPFAFNQMMLLYKRKGMMNKVTEILA----DMKTHGVPKDVY- 161

Query: 279 TYQAILDWCAEKGDVKRAEKVIKDLKS 199
TY ++D A GD++ EK+ ++L +
Sbjct: 162 TYNILMDVKARSGDIEGMEKIFEELSA 188