BP920361
Clone id YMU001_000136_C01
Library
Length 500
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACATGAGATAAACCAAAATCATGCCAGCATCCAGTCCCACTAAAAGCACCAGGAGCCAG
GAGTGTGACCTACAAATTTTCAGGAATCGACAAGCCAGCAGGACCAGCCTCTGTGATAAC
TTTAGAACTGATTCTTATGCTAAGACTCTCAAAAAAGAATAGGAGCTAGTTCAAAGCCCA
AAACTCATCTAGTTACCTGTATTGAAAAATTACACTCTCTTCACACAACCTTCTTATATT
TTCTAACTGGACAGCAAAGCATAGTGCTCATGTTGAATCATTCATGAGAAACTCTGGATG
CTCAACCTTCAGCTGCTATCATGTCACCAGCGTGCAGCACTCCATTCTTTTGTGCTCCCG
CAAAGTTCTGATACTCTTATGTATTCGTGCACGCTCACCCCAATACTCTCACAAATTAAT
TTGCATGTTCGCTGATGGAGTGCCCATAAAGAGCCTAAATACTGCATAGAGACCCCAATT
GTCATCGACAGGAGCTCCTC
■■Homology search results ■■ -
sp_hit_id Q8BHN3
Definition sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus
Align length 36
Score (bit) 30.4
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920361|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_C01.
(500 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus muscul... 30 4.8
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa G... 30 8.2

>sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus
GN=Ganab PE=1 SV=1
Length = 944

Score = 30.4 bits (67), Expect = 4.8
Identities = 15/36 (41%), Positives = 17/36 (47%)
Frame = +2

Query: 8 DKPKSCQHPVPLKAPGARSVTYKFSGIDKPAGPASV 115
DKP+ Q PGA T+K KP GP SV
Sbjct: 209 DKPEETQEKAEKDEPGAWEETFKTHSDSKPYGPTSV 244


>sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa
GN=GANAB PE=1 SV=1
Length = 944

Score = 29.6 bits (65), Expect = 8.2
Identities = 15/36 (41%), Positives = 17/36 (47%)
Frame = +2

Query: 8 DKPKSCQHPVPLKAPGARSVTYKFSGIDKPAGPASV 115
DKP+ Q PGA T+K KP GP SV
Sbjct: 209 DKPEEIQGKAEKDEPGAWEETFKTHSDSKPYGPTSV 244


tr_hit_id Q5ZWF0
Definition tr|Q5ZWF0|Q5ZWF0_LEGPH Bacterial regulatory proteins, TetR family OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Align length 36
Score (bit) 35.8
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920361|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_C01.
(500 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5ZWF0|Q5ZWF0_LEGPH Bacterial regulatory proteins, TetR famil... 36 1.1
tr|Q5X634|Q5X634_LEGPA Putative uncharacterized protein OS=Legio... 36 1.1
tr|Q5WXF7|Q5WXF7_LEGPL Putative uncharacterized protein OS=Legio... 36 1.1
tr|A5IB30|A5IB30_LEGPC Bacterial regulatory protein OS=Legionell... 36 1.1

>tr|Q5ZWF0|Q5ZWF0_LEGPH Bacterial regulatory proteins, TetR family
OS=Legionella pneumophila subsp. pneumophila (strain
Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lpg1135 PE=4
SV=1
Length = 203

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/36 (47%), Positives = 23/36 (63%)
Frame = +3

Query: 159 IGASSKPKTHLVTCIEKLHSLHTTFLYFLTGQQSIV 266
+ ASS+PK L+T EKLH L T+L GQQ ++
Sbjct: 67 LNASSRPKFDLLTAKEKLHDLLMTWLSTFEGQQKVI 102


>tr|Q5X634|Q5X634_LEGPA Putative uncharacterized protein
OS=Legionella pneumophila (strain Paris) GN=lpp1136 PE=4
SV=1
Length = 203

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/36 (47%), Positives = 23/36 (63%)
Frame = +3

Query: 159 IGASSKPKTHLVTCIEKLHSLHTTFLYFLTGQQSIV 266
+ ASS+PK L+T EKLH L T+L GQQ ++
Sbjct: 67 LNASSRPKFDLLTAKEKLHDLLMTWLSTFEGQQKVI 102


>tr|Q5WXF7|Q5WXF7_LEGPL Putative uncharacterized protein
OS=Legionella pneumophila (strain Lens) GN=lpl1141 PE=4
SV=1
Length = 203

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/36 (47%), Positives = 23/36 (63%)
Frame = +3

Query: 159 IGASSKPKTHLVTCIEKLHSLHTTFLYFLTGQQSIV 266
+ ASS+PK L+T EKLH L T+L GQQ ++
Sbjct: 67 LNASSRPKFDLLTAKEKLHDLLMTWLSTFEGQQKVI 102


>tr|A5IB30|A5IB30_LEGPC Bacterial regulatory protein OS=Legionella
pneumophila (strain Corby) GN=LPC_0598 PE=4 SV=1
Length = 203

Score = 35.8 bits (81), Expect = 1.1
Identities = 17/36 (47%), Positives = 23/36 (63%)
Frame = +3

Query: 159 IGASSKPKTHLVTCIEKLHSLHTTFLYFLTGQQSIV 266
+ ASS+PK L+T EKLH L T+L GQQ ++
Sbjct: 67 LNASSRPKFDLLTAKEKLHDLLMTWLSTFEGQQKVI 102