BP920371
Clone id YMU001_000136_C12
Library
Length 597
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTGCACCATCTCTAATCTTCTCTTATTAGATTGAGCATTACGTGTCATTAGCACATTCG
CAGGTACAGACCCAAACGTGCAATTTCCGAGGTTCTCATTGATAGATCTGCAACCTCCTT
GCGGGCACAGATATCTGAACTCATCTAGTGCCTTTGTCGACCATTCTTGTGCATGCTTGC
CATCAGATGAGAGCCTTTCAACTGTGTCACTCCGGACAAAAGCAATATCACCAGTGCCGT
CAACAAGGCACCTAAATGCACCAGAGTAGCCCCCATACACAAGGCTTTCTGAGGTGCAAG
AGCCATTGTTGCCACAGGAAGTGCAAAGACCCTGTCCTGCCAATTCGGAGGGTGCGCAAG
TTGATGAGAAGAAACTTGAGACAACCGCTTCATCTCGACTCTGTGTGTCGCCGTTTGCCT
TCTTTGGTATTGCTTGCAATTCTGAATCCACCAAAAACTGAATCGGATAGTTCCATCCAG
CAGCGGTAAGGTGGTCACTGTGGCAGGATTTTGCACCCTTAAAATCTTTTAATGTCAAAT
GTGGATTCCTCTCGCATGTCTCCTTGTTTACAATAGCGACTTCTTCCAGTTGAGTAC
■■Homology search results ■■ -
sp_hit_id P02789
Definition sp|P02789|TRFE_CHICK Ovotransferrin OS=Gallus gallus
Align length 187
Score (bit) 94.4
E-value 4.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920371|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_C12.
(597 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P02789|TRFE_CHICK Ovotransferrin OS=Gallus gallus PE=1 SV=2 94 4e-19
sp|P56410|TRFE_ANAPL Ovotransferrin OS=Anas platyrhynchos PE=1 SV=1 93 1e-18
sp|Q02942|TRF_BLADI Transferrin OS=Blaberus discoidalis PE=1 SV=1 92 3e-18
sp|P08582|TRFM_HUMAN Melanotransferrin OS=Homo sapiens GN=MFI2 P... 91 6e-18
sp|P14632|TRFL_PIG Lactotransferrin OS=Sus scrofa GN=LTF PE=1 SV=3 91 6e-18
sp|O93429|TRFE_PAROL Serotransferrin OS=Paralichthys olivaceus G... 90 1e-17
sp|O97490|TRFM_RABIT Melanotransferrin OS=Oryctolagus cuniculus ... 89 2e-17
sp|Q9R0R1|TRFM_MOUSE Melanotransferrin OS=Mus musculus GN=Mfi2 P... 89 2e-17
sp|P02788|TRFL_HUMAN Lactotransferrin OS=Homo sapiens GN=LTF PE=... 88 3e-17
sp|P27425|TRFE_HORSE Serotransferrin OS=Equus caballus GN=TF PE=... 88 4e-17
sp|Q92079|TRFE_GADMO Serotransferrin (Fragment) OS=Gadus morhua ... 87 5e-17
sp|Q9TUM0|TRFL_CAMDR Lactotransferrin OS=Camelus dromedarius GN=... 87 8e-17
sp|P09571|TRFE_PIG Serotransferrin OS=Sus scrofa GN=TF PE=1 SV=2 87 8e-17
sp|Q29477|TRFL_CAPHI Lactotransferrin OS=Capra hircus GN=LTF PE=... 86 1e-16
sp|P80426|TRFE1_SALSA Serotransferrin-1 OS=Salmo salar GN=tf1 PE... 84 4e-16
sp|P80429|TRFE2_SALSA Serotransferrin-2 OS=Salmo salar GN=tf2 PE... 83 9e-16
sp|P08071|TRFL_MOUSE Lactotransferrin OS=Mus musculus GN=Ltf PE=... 83 1e-15
sp|P24627|TRFL_BOVIN Lactotransferrin OS=Bos taurus GN=LTF PE=1 ... 83 1e-15
sp|Q921I1|TRFE_MOUSE Serotransferrin OS=Mus musculus GN=Tf PE=1 ... 83 1e-15
sp|P19134|TRFE_RABIT Serotransferrin OS=Oryctolagus cuniculus GN... 82 2e-15
sp|P20233|TRFEA_XENLA Serotransferrin-A OS=Xenopus laevis GN=tf-... 82 2e-15
sp|Q29545|ICA_PIG Inhibitor of carbonic anhydrase OS=Sus scrofa ... 82 2e-15
sp|O77698|TRFL_BUBBU Lactotransferrin OS=Bubalus bubalis GN=LTF ... 82 3e-15
sp|A5A6I6|TRFE_PANTR Serotransferrin OS=Pan troglodytes GN=TF PE... 81 3e-15
sp|P79819|TRFE_ORYLA Serotransferrin OS=Oryzias latipes GN=tf PE... 81 3e-15
sp|P02787|TRFE_HUMAN Serotransferrin OS=Homo sapiens GN=TF PE=1 ... 81 5e-15
sp|Q501K5|TRFE_XENTR Serotransferrin OS=Xenopus tropicalis GN=tf... 80 6e-15
sp|P12346|TRFE_RAT Serotransferrin OS=Rattus norvegicus GN=Tf PE... 80 8e-15
sp|O77811|TRFL_HORSE Lactotransferrin (Fragment) OS=Equus caball... 80 1e-14
sp|P31226|SAX_RANCA Saxiphilin OS=Rana catesbeiana PE=1 SV=3 79 2e-14

>sp|P02789|TRFE_CHICK Ovotransferrin OS=Gallus gallus PE=1 SV=2
Length = 705

Score = 94.4 bits (233), Expect = 4e-19
Identities = 63/187 (33%), Positives = 88/187 (47%), Gaps = 1/187 (0%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K T T+ D +G SCH+ +AGWN PI L L +
Sbjct: 109 TSYYAVAVVKKGT-----EFTVNDLQGKTSCHTGLGRSAGWNIPIGTL----LHRGAIEW 159

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQGLCTSC-GNNGSCTSESLVYGGYSGAFRCLVD 239
G E V+ FFS++C P Q LC C G+ + + + Y GYSGAF CL D
Sbjct: 160 EGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKD 219

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPA 59
G GD+AFV+ TV + D K DE+ LC G + + +N C + V A
Sbjct: 220 GKGDVAFVKHTTVNENAPDQK----------DEYELLCLDGSRQPV-DNYKTCNWARVAA 268

Query: 58 NVLMTRN 38
+ ++ R+
Sbjct: 269 HAVVARD 275



Score = 80.9 bits (198), Expect = 5e-15
Identities = 58/195 (29%), Positives = 91/195 (46%), Gaps = 7/195 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+ K++ ++ + KG KSCH+ AGW P+ + + T
Sbjct: 453 VAVARKDS-----NVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRT----------GTC 497

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLV------YGGYSGAFRCLVD 239
+ DE +FS CAP LC C +G E V Y GY+GA RCLV+
Sbjct: 498 NFDE-----YFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVE 552

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFGSVP 62
GD+AF++ TVE ++ GK+ +W+ +D+F LC G ++ + C VP
Sbjct: 553 -KGDVAFIQHSTVEE-NTGGKNKADWAKNLQMDDFELLCTDGRRANVMD-YRECNLAEVP 609

Query: 61 ANVLMTRNAQSNKRR 17
+ ++ R ++NK R
Sbjct: 610 THAVVVRPEKANKIR 624


>sp|P56410|TRFE_ANAPL Ovotransferrin OS=Anas platyrhynchos PE=1 SV=1
Length = 686

Score = 92.8 bits (229), Expect = 1e-18
Identities = 63/189 (33%), Positives = 90/189 (47%), Gaps = 3/189 (1%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K T +KD +G SCH+ +AGWN PI L+ E +
Sbjct: 90 TSYYAVAVVKKGT-----DFMIKDLRGKTSCHTGLGRSAGWNIPIGTLIHRE----DIEW 140

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESL---VYGGYSGAFRCL 245
G E V+ FFS++C P Q LC C G ++ L Y GYSGAF+CL
Sbjct: 141 EGIESGISEQAVAKFFSASCVPGATIEQKLCRQC--KGDAKTKCLRNGPYSGYSGAFQCL 198

Query: 244 VDGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSV 65
DG GD+AFV+ TV QE + + DE+ LC G + + ++ C + V
Sbjct: 199 KDGKGDVAFVKHTTV----------QENAPEEKDEYELLCLDGSRQPV-DSYKTCNWARV 247

Query: 64 PANVLMTRN 38
A+ ++ R+
Sbjct: 248 AAHAVVARD 256



Score = 79.3 bits (194), Expect = 1e-14
Identities = 61/196 (31%), Positives = 89/196 (45%), Gaps = 8/196 (4%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K + +T + +G KSCH+ AGWN P+ + + T
Sbjct: 434 VAVVKKSSA-----ITWNNLQGKKSCHTAVGRTAGWNIPMGLI------------HNKTG 476

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLV------YGGYSGAFRCLVD 239
S D +FS CAP LC C +G E V Y GY+GA RCLV+
Sbjct: 477 SCD---FDDYFSEGCAPGSPPNSRLCKLCQGSGENLLEKCVASSHEKYYGYTGALRCLVE 533

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTKAL--DEFRYLCPQGGCRSINENLGNCTFGSV 65
GD+AF++ TV + G + +W+ K L D+F LC G R+ + C V
Sbjct: 534 -QGDVAFIKHSTVGE-NVSGSNKDDWA-KGLTRDDFELLCTNGK-RAKTMDYKTCHLAKV 589

Query: 64 PANVLMTRNAQSNKRR 17
P + ++ R ++NK R
Sbjct: 590 PTHAVVARPEKANKIR 605


>sp|Q02942|TRF_BLADI Transferrin OS=Blaberus discoidalis PE=1 SV=1
Length = 726

Score = 91.7 bits (226), Expect = 3e-18
Identities = 64/205 (31%), Positives = 98/205 (47%), Gaps = 20/205 (9%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K++ + +++D +GAKSCH+ + AGWN P+ L+ EL + ++
Sbjct: 460 VAVVRKDST----YQSIEDLRGAKSCHTGYGRNAGWNVPLYTLLSKEL------ISKNSC 509

Query: 400 SRDEAVVSSFFSSTCAPSELAGQG---------LCTSCGNN---------GSCT-SESLV 278
A+ S F +C P + LC+ C N C+ S
Sbjct: 510 PYSSALSSYFSGGSCVPGAQLPENNPANQNPDSLCSICAGNLDAPNNDPAWKCSASNDES 569

Query: 277 YGGYSGAFRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSI 101
+ GYSGAFRCL G G +AFV+ TV ++DG + W+ E F LC GG SI
Sbjct: 570 FFGYSGAFRCLASGEGQVAFVKHTTVPE-NTDGHNQAAWTAGLRSEDFELLCADGGRASI 628

Query: 100 NENLGNCTFGSVPANVLMTRNAQSN 26
NE C VP ++++T N +++
Sbjct: 629 NE-YSRCHLAEVPPHMVVTSNDKTD 652



Score = 45.4 bits (106), Expect = 2e-04
Identities = 45/171 (26%), Positives = 69/171 (40%), Gaps = 16/171 (9%)
Frame = -3

Query: 586 EEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGD 407
E V +++K+ + H +G KSCH+ G+ PI L + + N D
Sbjct: 112 EAVCVIHKDLDITSIH----GLQGLKSCHTGVGRNVGYKIPITKL--RHMGVLGPLNNSD 165

Query: 406 TQSRDEAV--VSSFFSSTC-----APSELAGQGL-------CTSCGNNGSCTSESLVYGG 269
R+ + +S FS C AP Q L C C + C Y G
Sbjct: 166 LTPRENELHALSHLFSEACLVGKWAPDPAQNQALKAKYPNLCALCEHPEICDYPDK-YSG 224

Query: 268 YSGAFRCLVDGTGDIAFVRSDTVERLSSDGKHAQEW--STKALDEFRYLCP 122
Y GA RCL + G +A+ + V++ A E + + D++ YLCP
Sbjct: 225 YDGALRCLAEHGGQVAWTKVYYVKKHFGMAIGAGEAVPTGQNPDDYAYLCP 275


>sp|P08582|TRFM_HUMAN Melanotransferrin OS=Homo sapiens GN=MFI2 PE=1
SV=1
Length = 738

Score = 90.5 bits (223), Expect = 6e-18
Identities = 60/179 (33%), Positives = 82/179 (45%), Gaps = 9/179 (5%)
Frame = -3

Query: 550 RNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSF 371
R+ H+T+ KG KSCH+ GWN P+ +LV+S ++ D VS +
Sbjct: 115 RSSHVTIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSV---MGCDVLK----AVSDY 167

Query: 370 FSSTCAP---SELAGQGLCTSC----GNNGSCTSESLV-YGGYSGAFRCLVDGTGDIAFV 215
F +C P + LC C G C L Y YSGAFRCL +G GD+AFV
Sbjct: 168 FGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFV 227

Query: 214 RSDTVERLSSDGKHAQEWSTKAL-DEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTR 41
+ TV ++DGK W L +F LC G + E C VPA+ ++ R
Sbjct: 228 KHSTVLE-NTDGKTLPSWGQALLSQDFELLCRDGSRADVTE-WRQCHLARVPAHAVVVR 284



Score = 85.5 bits (210), Expect = 2e-16
Identities = 57/189 (30%), Positives = 92/189 (48%), Gaps = 9/189 (4%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V +++ TL + +G +SCH+ + AGW+ P+ L+ PK + T
Sbjct: 454 VAVVRRDSSHA---FTLDELRGKRSCHAGFGSPAGWDVPVGALIQRGFIR-PKDCDVLT- 508

Query: 400 SRDEAVVSSFFSSTCAP---SELAGQGLCTSC-----GNNGSCTSESLVYGGYSGAFRCL 245
VS FF+++C P + LC C G N + Y GY GAFRCL
Sbjct: 509 -----AVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCL 563

Query: 244 VDGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSINENLGNCTFGS 68
V+ GD+AFVR TV +++G +++ W+ + E + LCP G +++ C
Sbjct: 564 VENAGDVAFVRHTTVFD-NTNGHNSEPWAAELRSEDYELLCPNGARAEVSQ-FAACNLAQ 621

Query: 67 VPANVLMTR 41
+P + +M R
Sbjct: 622 IPPHAVMVR 630


>sp|P14632|TRFL_PIG Lactotransferrin OS=Sus scrofa GN=LTF PE=1 SV=3
Length = 704

Score = 90.5 bits (223), Expect = 6e-18
Identities = 58/190 (30%), Positives = 89/190 (46%), Gaps = 6/190 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K N +T +G KSCH+ AGWN P+ LV+
Sbjct: 451 VAVVRKA----NGGITWNSVRGTKSCHTAVDRTAGWNIPMGLLVNQT------------- 493

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLV-----YGGYSGAFRCLVDG 236
FFS +CAP G LC C N + + Y GY+GAFRCL +
Sbjct: 494 --GSCKFDEFFSQSCAPGSQPGSNLCALCVGNDQGVDKCVPNSNERYYGYTGAFRCLAEN 551

Query: 235 TGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFGSVPA 59
GD+AFV+ TV +++G++ +EW+ + D+F LC G + + E NC P+
Sbjct: 552 AGDVAFVKDVTVLD-NTNGQNTEEWARELRSDDFELLCLDGTRKPVTE-AQNCHLAVAPS 609

Query: 58 NVLMTRNAQS 29
+ +++R ++
Sbjct: 610 HAVVSRKEKA 619



Score = 73.2 bits (178), Expect = 9e-13
Identities = 56/180 (31%), Positives = 79/180 (43%), Gaps = 7/180 (3%)
Frame = -3

Query: 532 LKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSFFSSTCA 353
L +G KSCH+ +AGWN PI L A P + + V+ FFS +C
Sbjct: 121 LNQLQGRKSCHTGLGRSAGWNIPIGLLRRFLDWAGPPEPL-------QKAVAKFFSQSCV 173

Query: 352 PSE--LAGQGLCTSCGNNG----SCTSESLVYGGYSGAFRCLVDGTGDIAFVRSDTV-ER 194
P A LC C G +C+S+ Y GYSGAF CL G GD+AFV+ TV E
Sbjct: 174 PCADGNAYPNLCQLCIGKGKDKCACSSQE-PYFGYSGAFNCLHKGIGDVAFVKESTVFEN 232

Query: 193 LSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTRNAQSNKRRL 14
L D++ LCP + + E C VP++ ++ R+ + +
Sbjct: 233 LPQKADR---------DKYELLCPDNTRKPV-EAFRECHLARVPSHAVVARSVNGKENSI 282


>sp|O93429|TRFE_PAROL Serotransferrin OS=Paralichthys olivaceus
GN=tf PE=2 SV=1
Length = 685

Score = 89.7 bits (221), Expect = 1e-17
Identities = 56/171 (32%), Positives = 81/171 (47%)
Frame = -3

Query: 553 ERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSS 374
++N L G KSCH+ +AGWN PI L+ + K G + E VV
Sbjct: 109 KKNTGFGLHQLMGKKSCHTGVGKSAGWNIPIGTLLSMDFI----KWKGSDDKKLEEVVGE 164

Query: 373 FFSSTCAPSELAGQGLCTSCGNNGSCTSESLVYGGYSGAFRCLVDGTGDIAFVRSDTVER 194
FF S+CAP LC C + S +SE+ Y Y GAF+CL DG GD+AFV+ TV
Sbjct: 165 FFHSSCAPGATDSANLCKLCIGDCSKSSETEPYYNYHGAFQCLKDGKGDVAFVKHLTVPE 224

Query: 193 LSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTR 41
+ +++ LC + I++ NC VP++ ++TR
Sbjct: 225 -------------EEKNDYELLCKDNTRKPIDQ-FENCDLAKVPSHAVVTR 261



Score = 85.1 bits (209), Expect = 2e-16
Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 6/172 (3%)
Frame = -3

Query: 538 LTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSFFSST 359
+T ++ + +SCH+ AGWN P+ + + K N S+FFSS+
Sbjct: 440 VTWENLRNKRSCHTGIGRNAGWNIPMGLIYEQT-----KNCN----------FSAFFSSS 484

Query: 358 CAPSELAGQGLCTSCGNNGSCTSESLV-----YGGYSGAFRCLVDGTGDIAFVRSDTVER 194
CAP LC C N ++ Y Y+GAFRCL +G GD+AFV+ V+
Sbjct: 485 CAPGADPSSQLCAQCAGNAESINKCKASNEERYYAYAGAFRCLAEGKGDVAFVKHSIVKE 544

Query: 193 LSSDGKHAQEWSTKAL-DEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTR 41
++DG+ EW+ L +++ +CP G S+ EN +C V A+ ++TR
Sbjct: 545 -NTDGQ-GPEWAKAFLSNDYELICPSKGPVSV-ENFMSCNLAKVNAHAVVTR 593


>sp|O97490|TRFM_RABIT Melanotransferrin OS=Oryctolagus cuniculus
GN=Mfi2 PE=2 SV=1
Length = 736

Score = 88.6 bits (218), Expect = 2e-17
Identities = 58/180 (32%), Positives = 85/180 (47%), Gaps = 9/180 (5%)
Frame = -3

Query: 553 ERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSS 374
+R+ ++T+ +G KSCH+ GWN P+ +LVDS ++ D VS
Sbjct: 114 KRSSNVTINTLRGVKSCHTGINRTVGWNVPVGYLVDSGRLSV---MGCDVLK----AVSE 166

Query: 373 FFSSTCAPSE---LAGQGLCTSC----GNNGSCTSESLV-YGGYSGAFRCLVDGTGDIAF 218
+F +C P + LC C G C L Y YSGAFRCL +G GD+AF
Sbjct: 167 YFGGSCVPGAGETRYSESLCRLCRGDTSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAF 226

Query: 217 VRSDTVERLSSDGKHAQEWSTKALD-EFRYLCPQGGCRSINENLGNCTFGSVPANVLMTR 41
V+ TV ++DG+ W + +F LC G S+ E +C VPA+ ++ R
Sbjct: 227 VKHSTVLE-NTDGRTLPSWGHMLMSRDFELLCRDGSRASVTE-WQHCHLARVPAHAVVVR 284



Score = 78.2 bits (191), Expect = 3e-14
Identities = 56/190 (29%), Positives = 91/190 (47%), Gaps = 10/190 (5%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V +++ T+ + +G +SCH + AGW+ P+ L+ + N D
Sbjct: 454 VAVVKRDSAYA---FTVDELRGKRSCHPGFGSPAGWDVPVGALIH---WGYIRPRNCDVL 507

Query: 400 SRDEAVVSSFFSSTCAP---SELAGQGLCTSC-----GNNGSCTSESLV-YGGYSGAFRC 248
+ V FF+++C P + LC C G N CT S Y G SGAFRC
Sbjct: 508 T----AVGQFFNASCVPVNNPKKYPSSLCALCVGDEQGRN-KCTGNSQERYYGDSGAFRC 562

Query: 247 LVDGTGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFG 71
LV+G GD+AFV+ T+ +++G + + W+ ++ LCP G R+ C
Sbjct: 563 LVEGAGDVAFVKHTTIFD-NTNGHNPEPWAAHLRSQDYELLCP-NGARAEAHQFAACNLA 620

Query: 70 SVPANVLMTR 41
+P++ +M R
Sbjct: 621 QIPSHAVMVR 630


>sp|Q9R0R1|TRFM_MOUSE Melanotransferrin OS=Mus musculus GN=Mfi2 PE=2
SV=1
Length = 738

Score = 88.6 bits (218), Expect = 2e-17
Identities = 61/183 (33%), Positives = 84/183 (45%), Gaps = 13/183 (7%)
Frame = -3

Query: 550 RNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPK----KANGDTQSRDEAV 383
RN ++T+ KG KSCH+ GWN P+ +LV+S ++ KA GD
Sbjct: 115 RNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGD-------- 166

Query: 382 VSSFFSSTCAPSE---LAGQGLCTSCGNNGS----CTSESLV-YGGYSGAFRCLVDGTGD 227
+F +C P + LC C + S C L Y YSGAFRCL +G GD
Sbjct: 167 ---YFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGD 223

Query: 226 IAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSINENLGNCTFGSVPANVL 50
+AFV+ TV ++DG W + E F+ LC G I E C VPA+ +
Sbjct: 224 VAFVKHSTVLE-NTDGNTLPSWGKSLMSEDFQLLCRDGSRADITE-WRRCHLAKVPAHAV 281

Query: 49 MTR 41
+ R
Sbjct: 282 VVR 284



Score = 80.5 bits (197), Expect = 6e-15
Identities = 56/174 (32%), Positives = 84/174 (48%), Gaps = 9/174 (5%)
Frame = -3

Query: 535 TLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSFFSSTC 356
TL + +G +SCH + AGW PI L+ PK + T VS FF+++C
Sbjct: 466 TLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIR-PKDCDVLT------AVSQFFNASC 518

Query: 355 AP---SELAGQGLCTSC-----GNNGSCTSESLVYGGYSGAFRCLVDGTGDIAFVRSDTV 200
P + LC C G N S Y GYSGAFRCLV+ GD+AFV+ TV
Sbjct: 519 VPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTV 578

Query: 199 ERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTR 41
+++G + + W++ ++ LCP G R+ + C +P++ +M R
Sbjct: 579 FE-NTNGHNPEPWASHLRWQDYELLCP-NGARAEVDQFQACNLAQMPSHAVMVR 630


>sp|P02788|TRFL_HUMAN Lactotransferrin OS=Homo sapiens GN=LTF PE=1
SV=6
Length = 710

Score = 88.2 bits (217), Expect = 3e-17
Identities = 63/197 (31%), Positives = 87/197 (44%), Gaps = 6/197 (3%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K L + +G KSCH+ AGWN PI L P +
Sbjct: 109 THYYAVAVVKK-----GGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEP 163

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQ-----GLCTSCGNNGSCTSESLVYGGYSGAFR 251
EA V+ FFS++C P GQ LC G N S Y YSGAF+
Sbjct: 164 I-------EAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFK 216

Query: 250 CLVDGTGDIAFVRSDTV-ERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTF 74
CL DG GD+AF+R TV E LS + + DE+ LCP + + + +C
Sbjct: 217 CLRDGAGDVAFIRESTVFEDLSDEAER---------DEYELLCPDNTRKPV-DKFKDCHL 266

Query: 73 GSVPANVLMTRNAQSNK 23
VP++ ++ R+ +
Sbjct: 267 ARVPSHAVVARSVNGKE 283



Score = 79.7 bits (195), Expect = 1e-14
Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 6/186 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V + + LT KG KSCH+ AGWN P+ L +
Sbjct: 457 VAVVRRS----DTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQT------------- 499

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSC-----GNNGSCTSESLVYGGYSGAFRCLVDG 236
+FS +CAP LC C G N + + Y GY+GAFRCL +
Sbjct: 500 --GSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAEN 557

Query: 235 TGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFGSVPA 59
GD+AFV+ TV + ++DG + + W+ L +F LC G + + E +C P
Sbjct: 558 AGDVAFVKDVTVLQ-NTDGNNNEAWAKDLKLADFALLCLDGKRKPVTE-ARSCHLAMAPN 615

Query: 58 NVLMTR 41
+ +++R
Sbjct: 616 HAVVSR 621


>sp|P27425|TRFE_HORSE Serotransferrin OS=Equus caballus GN=TF PE=2
SV=1
Length = 706

Score = 87.8 bits (216), Expect = 4e-17
Identities = 61/191 (31%), Positives = 90/191 (47%), Gaps = 7/191 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V + +P LT KG KSCH+ AGWN P+ L SE++
Sbjct: 452 VAVVKSSS---DPDLTWNSLKGKKSCHTGVDRTAGWNIPMGLLY-SEIK----------- 496

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLV------YGGYSGAFRCLVD 239
FF CAP LC C + S Y GY+GAFRCLV+
Sbjct: 497 ---HCEFDKFFREGCAPGYRRNSTLCNLCIGSASGPGRECEPNNHERYYGYTGAFRCLVE 553

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSINENLGNCTFGSVP 62
GD+AFV+ TVE+ ++DG++ +W+ E F+ LCP G +S+ E +C P
Sbjct: 554 -KGDVAFVKHQTVEQ-NTDGRNPDDWAKDLKSENFKLLCPDGTRKSVTE-FKSCYLARAP 610

Query: 61 ANVLMTRNAQS 29
+ +++R ++
Sbjct: 611 NHAVVSRKEKA 621



Score = 87.0 bits (214), Expect = 6e-17
Identities = 62/197 (31%), Positives = 92/197 (46%), Gaps = 6/197 (3%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K N + L +G KSCH+ +AGWN PI L +P
Sbjct: 109 THYYAVAVVKK-----NSNFQLNQLQGKKSCHTGLGRSAGWNIPIGLLY----WQLP--- 156

Query: 415 NGDTQSRDEAVVSSFFSSTCAP--SELAGQGLCTSCGNNGS---CTSESLVYGGYSGAFR 251
+ + + VS+FF+ +C P A LC C G+ S Y GYSGAF+
Sbjct: 157 --EPRESLQKAVSNFFAGSCVPCADRTAVPNLCQLCVGKGTDKCACSNHEPYFGYSGAFK 214

Query: 250 CLVDGTGDIAFVRSDTV-ERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTF 74
CL DG GD+AFV+ TV E L + DE++ LC +S++E +C
Sbjct: 215 CLADGAGDVAFVKHSTVLENLPQEADR---------DEYQLLCRDNTRKSVDE-YKDCYL 264

Query: 73 GSVPANVLMTRNAQSNK 23
S+P++ ++ R+ +
Sbjct: 265 ASIPSHAVVARSVDGKE 281


tr_hit_id B8LL89
Definition tr|B8LL89|B8LL89_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 195
Score (bit) 230.0
E-value 5.0e-59
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920371|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_C12.
(597 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LL89|B8LL89_PICSI Putative uncharacterized protein OS=Picea... 230 5e-59
tr|Q206Z4|Q206Z4_9CHLO Transferrin protein (Fragment) OS=Chlamyd... 121 3e-26
tr|B2GUT1|B2GUT1_XENTR LOC100158653 protein (Fragment) OS=Xenopu... 114 6e-24
tr|B6LLS8|B6LLS8_BRAFL Putative uncharacterized protein (Fragmen... 110 5e-23
tr|B6LLS9|B6LLS9_BRAFL Putative uncharacterized protein (Fragmen... 106 1e-21
tr|B6MWN6|B6MWN6_BRAFL Putative uncharacterized protein OS=Branc... 102 1e-20
tr|B3RM77|B3RM77_TRIAD Putative uncharacterized protein OS=Trich... 99 1e-19
tr|Q1EL70|Q1EL70_EUBMA Transferrin OS=Eublepharis macularius GN=... 97 5e-19
tr|Q92062|Q92062_CHICK Melanotransferrin/EOS47 OS=Gallus gallus ... 96 1e-18
tr|Q4ADJ7|Q4ADJ7_CHICK Ovotransferrin BB type OS=Gallus gallus G... 95 3e-18
tr|Q4ADJ6|Q4ADJ6_CHICK Ovotransferrin CC type OS=Gallus gallus G... 95 3e-18
tr|Q4ADG4|Q4ADG4_CHICK Ovotransferrin BC type OS=Gallus gallus G... 95 3e-18
tr|Q1EL67|Q1EL67_CRONI Transferrin OS=Crocodylus niloticus GN=tr... 94 6e-18
tr|Q1EL69|Q1EL69_LACAG Transferrin OS=Lacerta agilis GN=trfe PE=... 94 8e-18
tr|Q53HY1|Q53HY1_MELGA Iron binding protein OS=Meleagris gallopa... 93 1e-17
tr|Q8MU80|Q8MU80_MASDA Transferrin OS=Mastotermes darwiniensis P... 92 2e-17
tr|Q6A168|Q6A168_STRCA Iron binding protein OS=Struthio camelus ... 91 4e-17
tr|Q7YS20|Q7YS20_PIG Lactoferrin OS=Sus scrofa PE=2 SV=1 91 4e-17
tr|Q8WMN8|Q8WMN8_PIG Lactoferrin (Fragment) OS=Sus scrofa GN=LTF... 91 7e-17
tr|Q6YT39|Q6YT39_PIG Lactotransferrin OS=Sus scrofa GN=LTF PE=4 ... 91 7e-17
tr|Q6YST2|Q6YST2_PIG Lactotransferrin (Fragment) OS=Sus scrofa G... 91 7e-17
tr|A0FJ29|A0FJ29_PIG Lactoferrin OS=Sus scrofa PE=2 SV=1 91 7e-17
tr|Q9IA83|Q9IA83_PAROL Transferrin OS=Paralichthys olivaceus PE=... 90 9e-17
tr|Q9IA82|Q9IA82_PAROL Transferrin OS=Paralichthys olivaceus PE=... 90 9e-17
tr|Q1EL72|Q1EL72_ANOSA Transferrin OS=Anolis sagrei GN=trfe PE=2... 89 1e-16
tr|Q6A169|Q6A169_9SAUR Iron binding protein OS=Chrysemys scripta... 89 2e-16
tr|Q7TSX8|Q7TSX8_MARMO Transferrin OS=Marmota monax PE=2 SV=1 89 2e-16
tr|B3VMW0|B3VMW0_HUMAN Lactoferrin OS=Homo sapiens PE=2 SV=1 89 2e-16
tr|Q544J8|Q544J8_MOUSE Putative uncharacterized protein OS=Mus m... 89 2e-16
tr|B1Q146|B1Q146_MACCY Lactoferrin OS=Macaca cyclopis PE=2 SV=1 89 2e-16

>tr|B8LL89|B8LL89_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 509

Score = 230 bits (586), Expect = 5e-59
Identities = 104/195 (53%), Positives = 146/195 (74%)
Frame = -3

Query: 586 EEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGD 407
+ VA+VNK C + +L+L +F+G KSCH+ ++TAAGWNYP+ +LV S L+ P K+
Sbjct: 224 DAVAVVNKRMCNKKSNLSLNNFRGMKSCHAGYMTAAGWNYPVHYLVSSVLRQQPGKSL-- 281

Query: 406 TQSRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLVYGGYSGAFRCLVDGTGD 227
+ DEA++S+FFS++CAPSE+ G+GLC++CGN+ SC ++ Y GYSGAFRCLV+G GD
Sbjct: 282 SARNDEAIISNFFSASCAPSEVEGRGLCSACGNSSSCLPDN-TYSGYSGAFRCLVEGIGD 340

Query: 226 IAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPANVLM 47
IAF+++DT S +G Q WSTK++ +F YLCPQGGCR IN N G+C FGSVPAN +M
Sbjct: 341 IAFLKADTALLYSLEGLSNQSWSTKSISDFMYLCPQGGCRPINNNPGDCKFGSVPANTIM 400

Query: 46 TRNAQSNKRRLEMVQ 2
TRN+ + ++L +VQ
Sbjct: 401 TRNSLPHSKKLAIVQ 415


>tr|Q206Z4|Q206Z4_9CHLO Transferrin protein (Fragment)
OS=Chlamydomonas sp. ICE-L PE=2 SV=1
Length = 401

Score = 121 bits (304), Expect = 3e-26
Identities = 67/187 (35%), Positives = 98/187 (52%), Gaps = 7/187 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLV-DSELQAIPKKANGDT 404
VA+V K C+ + T + KG +SCH+ +GW P+ ++ ++ + I AN
Sbjct: 50 VAVVKKSWCDARTNPTFSNLKGQRSCHTGFRKTSGWTLPVGYMTANNVMSVISSNAN--- 106

Query: 403 QSRDEAVVSSFFSSTCAPSELAG------QGLCTSCGNNGSCTSESLVYGGYSGAFRCLV 242
+ D V+ FFSS CAP GLC+ CG G C S+SL Y GY+GA RC++
Sbjct: 107 VADDAETVAGFFSSVCAPGGSPNTNGGTYSGLCSGCGQAG-CGSDSL-YEGYAGAMRCMM 164

Query: 241 DGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVP 62
DG GD+AFV+ T + +G A+ WST ++ R LCP GGC +N+ +C
Sbjct: 165 DGNGDVAFVKQSTPIDYARNGGSAKAWSTLNQNDMRLLCPNGGCVPLNQ-YDSCHIAKAA 223

Query: 61 ANVLMTR 41
A + R
Sbjct: 224 ARAFVAR 230


>tr|B2GUT1|B2GUT1_XENTR LOC100158653 protein (Fragment) OS=Xenopus
tropicalis GN=LOC100158653 PE=2 SV=1
Length = 730

Score = 114 bits (284), Expect = 6e-24
Identities = 71/201 (35%), Positives = 99/201 (49%), Gaps = 3/201 (1%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K N T+ + KGAKSCH+ AGWN PI +L+DS A+
Sbjct: 110 TSYYAVAVVRK-----NSSYTINNLKGAKSCHTGFQRTAGWNVPIGYLIDSGRIAV---- 160

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQ--GLCTSCGNNGSCTSESLVYGGYSGAFRCLV 242
+ VSSFFS +C P LC N + + Y YSGAFRCLV
Sbjct: 161 ---VACNIQKAVSSFFSQSCVPGSTQADLCQLCIGDANGTNVCDLNGRYSDYSGAFRCLV 217

Query: 241 DGTGDIAFVRSDTVERLSSDGKHAQEWSTKAL-DEFRYLCPQGGCRSINENLGNCTFGSV 65
+G GD+AF++ TV +SDGK+ W+ + + +++ LC G I+E C V
Sbjct: 218 EGQGDVAFIKHSTVAE-NSDGKNTDSWAREVISSDYQLLCRDGSHADISE-WRQCNLARV 275

Query: 64 PANVLMTRNAQSNKRRLEMVQ 2
PA+ +MTR +M+Q
Sbjct: 276 PAHAVMTRTNTDGSLIYKMLQ 296



Score = 91.7 bits (226), Expect = 3e-17
Identities = 66/190 (34%), Positives = 95/190 (50%), Gaps = 12/190 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAI-PKKANGDT 404
VA+V ++ T+ D KG KSCH+ + AGWN PI L+ +L +I P + N
Sbjct: 453 VALVRRDPLNA---FTIHDLKGKKSCHTGYERTAGWNVPIGALI--KLGSIRPDECN--- 504

Query: 403 QSRDEAVVSSFFSSTCAPSELAGQG-----LCTSC-----GNNGSCTSESLVYGGYSGAF 254
V++FFS +C P A Q LC C G N Y GYSGAF
Sbjct: 505 ---TAKAVANFFSGSCVPG--ANQKNFPPELCKLCKGDSKGQNKCEKDTREQYFGYSGAF 559

Query: 253 RCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCT 77
RCL + GD+AFV+ TV L +DG+ + W+ +F+ LCP G +++ +C
Sbjct: 560 RCLAEKAGDVAFVKHATVFEL-TDGQSTESWAKNLKSSDFQLLCPNGARAEVSQ-YPDCN 617

Query: 76 FGSVPANVLM 47
+ VPA+ +M
Sbjct: 618 WAQVPAHAVM 627


>tr|B6LLS8|B6LLS8_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_168433 PE=4 SV=1
Length = 271

Score = 110 bits (276), Expect = 5e-23
Identities = 63/190 (33%), Positives = 102/190 (53%), Gaps = 4/190 (2%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GWN P+ +L+ + + K+ Q
Sbjct: 94 VAVVRKD----NQEININNLRGRKSCHTGIGKTSGWNVPVGWLIQNNQMQVAKR-----Q 144

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSC---GNNGSCTSESLVYGGYSGAFRCLVDGTG 230
S +AV FFS +C P + LC+ C G N + + Y GYSGAFRCLV+G G
Sbjct: 145 SVAQAV-GKFFSKSCVPGHTNPESLCSLCVGEGENRCVRNTNEPYYGYSGAFRCLVEGAG 203

Query: 229 DIAFVRSDTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNCTFGSVPANV 53
D+AF+ TV+ ++DG + + W+ EF LCP G R +++ C+ VP++
Sbjct: 204 DVAFINHQTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WRECSLARVPSHA 261

Query: 52 LMTRNAQSNK 23
+MT ++ +
Sbjct: 262 VMTSEERNQE 271


>tr|B6LLS9|B6LLS9_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_208920 PE=4 SV=1
Length = 685

Score = 106 bits (264), Expect = 1e-21
Identities = 59/183 (32%), Positives = 94/183 (51%), Gaps = 8/183 (4%)
Frame = -3

Query: 547 NPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSFF 368
NP + + + +G KSCH+ +GWN P+ +L+ + + D + V FF
Sbjct: 443 NPEINMNNLRGRKSCHTGISKTSGWNVPVGWLIQNNQMQV------DNKKSIPQAVGKFF 496

Query: 367 SSTCAPSELAG----QGLCTSC---GNNGSCTSESLVYGGYSGAFRCLVDGTGDIAFVRS 209
S +C P A + LC+ C G N + + Y GYSGAFRCLV+G GD+AF+
Sbjct: 497 SKSCVPEYNADGTNPKSLCSLCVGEGQNRCVRNTNEPYYGYSGAFRCLVEGAGDVAFINH 556

Query: 208 DTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNCTFGSVPANVLMTRNAQ 32
TV+ ++DG + + W+ EF LCP G R +++ C+ VP++ +MT +
Sbjct: 557 QTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WRECSLARVPSHAVMTSEDK 614

Query: 31 SNK 23
S +
Sbjct: 615 SQQ 617



Score = 102 bits (253), Expect = 2e-20
Identities = 61/192 (31%), Positives = 96/192 (50%), Gaps = 11/192 (5%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GWN P+ +L+ + K+ D +
Sbjct: 86 VAVVRKD----NQEINMNNLRGHKSCHTGISKTSGWNVPVGWLIQN------KQMQVDNK 135

Query: 400 SRDEAVVSSFFSSTCAPS--ELAGQG--------LCTSCGNNGSCTSESLVYGGYSGAFR 251
V FFS +C P E Q LC G + + + Y GY+GAFR
Sbjct: 136 KSIPQAVGMFFSKSCVPGHPEYDPQNTNPSNLCSLCAGAGEDHCVRNRNEPYYGYAGAFR 195

Query: 250 CLVDGTGDIAFVRSDTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNCTF 74
CLV+G GD+AF+ TV+ ++DG + + W+ EF LCP G R +++ C+
Sbjct: 196 CLVEGAGDVAFINHQTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WRECSL 253

Query: 73 GSVPANVLMTRN 38
VP++ +MT N
Sbjct: 254 ARVPSHAVMTSN 265


>tr|B6MWN6|B6MWN6_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_124962 PE=4 SV=1
Length = 3583

Score = 102 bits (255), Expect = 1e-20
Identities = 66/192 (34%), Positives = 98/192 (51%), Gaps = 13/192 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GWN P+ +L+ + + K+ Q
Sbjct: 351 VAVVRKD----NQEININNLRGRKSCHTGIGKTSGWNVPVGWLIQNNQMQVAKR-----Q 401

Query: 400 SRDEAVVSSFFSSTCAPSELA---------GQGLCTSC---GNNGSCTSESLVYGGYSGA 257
S +AV FFS +C P + + LC+ C G N + + Y GYSGA
Sbjct: 402 SVAQAV-GKFFSKSCVPGAQSLEYDPDSTNPESLCSLCVGEGENRCVRNTNEPYYGYSGA 460

Query: 256 FRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTKA-LDEFRYLCPQGGCRSINENLGNC 80
FRCLV+G GD+AFV TV +++G +EW+ D+F LCP G R N+ C
Sbjct: 461 FRCLVEGAGDVAFVNHVTVYE-NTNGHSEEEWARNLNEDDFELLCPDGSRRPWNQ-YKEC 518

Query: 79 TFGSVPANVLMT 44
VPA+ +MT
Sbjct: 519 NLARVPAHAVMT 530



Score = 100 bits (250), Expect = 5e-20
Identities = 63/192 (32%), Positives = 93/192 (48%), Gaps = 13/192 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GWN P+ +L+ + + D +
Sbjct: 1062 VAVVRKD----NQEINMNNLQGRKSCHTGISKTSGWNVPVGWLIQNNQMQV------DNK 1111

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ---------GLCTSC---GNNGSCTSESLVYGGYSGA 257
V FFS +C P + LC+ C G N + + Y GYSGA
Sbjct: 1112 KSIPQAVGKFFSKSCVPGAQSPDYNPDGTNPDSLCSLCVGEGENRCVRNTNEPYYGYSGA 1171

Query: 256 FRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTKA-LDEFRYLCPQGGCRSINENLGNC 80
FRCLV+G GD+AFV TV +++G +EW+ D+F LCP G R N+ C
Sbjct: 1172 FRCLVEGAGDVAFVNHVTVYE-NTNGHSEEEWARNLNEDDFELLCPDGSRRPWNQ-YKEC 1229

Query: 79 TFGSVPANVLMT 44
VPA+ +MT
Sbjct: 1230 NLARVPAHAVMT 1241



Score = 100 bits (248), Expect = 8e-20
Identities = 60/194 (30%), Positives = 96/194 (49%), Gaps = 13/194 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GW P +LVD + + D Q
Sbjct: 1419 VAVVRKD----NQEIDMNNLRGRKSCHTGIGKTSGWIIPTGWLVDQDF------VHTDGQ 1468

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ------------GLCTSCGNNGSCTSESLVYGGYSGA 257
+ V FFS +C P + + LC G++ + + Y GY+GA
Sbjct: 1469 TSLVQAVGDFFSQSCVPGAKSPEYDPQNTNPSNLCSLCAGAGDDHCVRNRNEPYYGYAGA 1528

Query: 256 FRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNC 80
FRCLV+G GD+AF+ TV+ ++DG + + W+ EF LCP G R +++ C
Sbjct: 1529 FRCLVEGAGDVAFINHQTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WREC 1586

Query: 79 TFGSVPANVLMTRN 38
+ VP++ +MT N
Sbjct: 1587 SLARVPSHAVMTSN 1600



Score = 98.6 bits (244), Expect = 2e-19
Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 13/199 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GW P +LVD + + D Q
Sbjct: 708 VAVVRKD----NQEIDMNNLRGRKSCHTGIGKTSGWIIPTGWLVDQDF------VHTDGQ 757

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ------------GLCTSCGNNGSCTSESLVYGGYSGA 257
+ V FFS +C P + + LC G + +++ Y GY+GA
Sbjct: 758 TSLVQAVGDFFSQSCVPGAKSPEYDPQNTNPSNLCSLCAGAGEDHCVRNKNEPYYGYAGA 817

Query: 256 FRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNC 80
FRCLV+G GD+AF+ TV+ ++DG + + W+ EF LCP G R +++ C
Sbjct: 818 FRCLVEGAGDVAFINHQTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WREC 875

Query: 79 TFGSVPANVLMTRNAQSNK 23
+ VP++ +MT ++ +
Sbjct: 876 SLARVPSHAVMTSEERTQE 894



Score = 98.6 bits (244), Expect = 2e-19
Identities = 60/196 (30%), Positives = 101/196 (51%), Gaps = 14/196 (7%)
Frame = -3

Query: 547 NPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRDEAVVSSFF 368
NP + + + +G KSCH+ +GWN P+ +L+ + + D++ V FF
Sbjct: 1780 NPEINMNNLRGRKSCHTGISKTSGWNVPVGWLIQNNQMQV------DSKKSIPQAVGKFF 1833

Query: 367 SSTCAPSELAGQ---------GLCTSC---GNNGSCTSESLVYGGYSGAFRCLVDGTGDI 224
S +C P + + LC+ C G N + + Y GYSGAFRCLV+G GD+
Sbjct: 1834 SKSCVPGAQSPEYNPDSTNPKSLCSLCVGEGENRCVRNTNEPYYGYSGAFRCLVEGAGDV 1893

Query: 223 AFVRSDTVERLSSDGKHAQEWSTKALDE--FRYLCPQGGCRSINENLGNCTFGSVPANVL 50
AFV +T+ +++G+ ++W T+ L+E + LCP G + ++ +C VP++ +
Sbjct: 1894 AFVNHNTIFE-NTNGRSEEQW-TRNLNENDYELLCPDGSRKQWHQ-YKDCNLARVPSHAV 1950

Query: 49 MTRNAQSNKRRLEMVQ 2
MT S + R E+ Q
Sbjct: 1951 MT----SPRSRSELQQ 1962



Score = 98.6 bits (244), Expect = 2e-19
Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 13/199 (6%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K+ N + + + +G KSCH+ +GW P +LVD + + D Q
Sbjct: 2129 VAVVRKD----NQEIDMNNLRGRKSCHTGIGKTSGWIIPTGWLVDQDF------VHTDGQ 2178

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ------------GLCTSCGNNGSCTSESLVYGGYSGA 257
+ V FFS +C P + + LC G + +++ Y GY+GA
Sbjct: 2179 TSLVQAVGDFFSQSCVPGAKSPEYDPQNTNPSNLCSLCAGAGEDHCVRNKNEPYYGYAGA 2238

Query: 256 FRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWST-KALDEFRYLCPQGGCRSINENLGNC 80
FRCLV+G GD+AF+ TV+ ++DG + + W+ EF LCP G R +++ C
Sbjct: 2239 FRCLVEGAGDVAFINHQTVQD-NTDGHNPENWAAGLRSSEFELLCPDGSRRPVDQ-WREC 2296

Query: 79 TFGSVPANVLMTRNAQSNK 23
+ VP++ +MT ++ +
Sbjct: 2297 SLARVPSHAVMTSEERTQE 2315


>tr|B3RM77|B3RM77_TRIAD Putative uncharacterized protein OS=Trichoplax
adhaerens GN=TRIADDRAFT_52263 PE=4 SV=1
Length = 754

Score = 99.4 bits (246), Expect = 1e-19
Identities = 61/204 (29%), Positives = 104/204 (50%), Gaps = 15/204 (7%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+ K++ ++LK+ +GAKSCH+ AGWN P+ L+ + +P+K + D
Sbjct: 454 VAVARKQSST----ISLKNMRGAKSCHTGINKTAGWNIPVGLLLSKNI--MPRKRSCDVA 507

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ---------GLCTSC-----GNNGSCTSESLVYGGYS 263
V SFF ++CAP L+ + LC+ C G N + + Y Y+
Sbjct: 508 YN----VGSFFEASCAPGALSAEYNPIGDNPSNLCSLCVGDSNGKNKCARNSNERYYNYA 563

Query: 262 GAFRCLVDGTGDIAFVRSDTVERLSSDGKHAQEW-STKALDEFRYLCPQGGCRSINENLG 86
GAFRCL + GD+AF++ TV +++GK+ W S D+F LC G + + +
Sbjct: 564 GAFRCLAEKAGDVAFIKHLTVNE-NTNGKNTASWASNLKSDDFELLCEDGSRKPVTQ-YT 621

Query: 85 NCTFGSVPANVLMTRNAQSNKRRL 14
C VP++ ++T + +S+ ++
Sbjct: 622 QCNLARVPSHAIVTSSLRSSTNQI 645



Score = 94.4 bits (233), Expect = 5e-18
Identities = 63/200 (31%), Positives = 97/200 (48%), Gaps = 14/200 (7%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V ++ L+LKD KG KSCH+ AGWN P+ +L++ + P+ N
Sbjct: 110 VALVRNDS-----QLSLKDLKGTKSCHTGIGKTAGWNIPVSYLIEQQFMR-PQNCNIPLS 163

Query: 400 SRDEAVVSSFFSSTCAPSELAGQ---------GLCTSC-----GNNGSCTSESLVYGGYS 263
V ++FS +CAP L+ + LC C GNN S Y GY+
Sbjct: 164 ------VGNYFSKSCAPGALSSKYNPYGNNPSNLCALCVGDASGNNKCARDSSERYYGYA 217

Query: 262 GAFRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGN 83
GAFRCL + GD+AFV+ TV ++ + +R LC + G +++ +
Sbjct: 218 GAFRCLQEAAGDVAFVKQSTV----------FDYDKQNSSYYRLLC-KDGTKAMPADYKK 266

Query: 82 CTFGSVPANVLMTRNAQSNK 23
C VPA+ +M +A++NK
Sbjct: 267 CNLAKVPAHAVMV-SAKTNK 285


>tr|Q1EL70|Q1EL70_EUBMA Transferrin OS=Eublepharis macularius
GN=trfe PE=2 SV=1
Length = 703

Score = 97.4 bits (241), Expect = 5e-19
Identities = 64/187 (34%), Positives = 89/187 (47%), Gaps = 1/187 (0%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K T +L D +G KSCH+ +AGWN PI L++ A
Sbjct: 101 TSYYTVAVVKKGTVN-----SLSDLRGKKSCHTGFGRSAGWNVPIGILLEKGYMQWAGAA 155

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCT-SESLVYGGYSGAFRCLVD 239
N Q V+ FF ++C P LC C G S S Y GYSGA RCL+D
Sbjct: 156 NEPIQK----AVARFFLASCVPGVPNEPSLCRLCIGEGEAKCSASDPYAGYSGALRCLMD 211

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPA 59
G GD+AFV+ +TV LS + + +++ LC G R + E +C VPA
Sbjct: 212 GVGDVAFVKQETVLSLSEEER----------NKYELLCYDGTKRPV-EQYRSCNLARVPA 260

Query: 58 NVLMTRN 38
+ ++ R+
Sbjct: 261 HAVVARS 267



Score = 89.7 bits (221), Expect = 1e-16
Identities = 61/182 (33%), Positives = 87/182 (47%), Gaps = 9/182 (4%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+V K N +T K+ +G KSCH+ AGWN P+ +++ G T
Sbjct: 442 VAVVKKS----NRKITWKNLRGKKSCHTGRDRTAGWNIPMGMIINE---------TGITD 488

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESL--------VYGGYSGAFRCL 245
V FFS CAP LC+ C +GS S+ +Y GY+GAFRCL
Sbjct: 489 ------VDHFFSEGCAPGSPPESPLCSLCVGSGSSISDQYKCAPNSHELYYGYTGAFRCL 542

Query: 244 VDGTGDIAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSINENLGNCTFGS 68
V+ GD+ FV+ TV +++G + + W++K E F LC G R I + +C G
Sbjct: 543 VE-KGDVCFVKGTTVPE-NTNGNNQEAWASKLKSEDFELLCRNGERRPITSS-SDCNLGQ 599

Query: 67 VP 62
P
Sbjct: 600 AP 601


>tr|Q92062|Q92062_CHICK Melanotransferrin/EOS47 OS=Gallus gallus
GN=EOS47 PE=2 SV=1
Length = 738

Score = 96.3 bits (238), Expect = 1e-18
Identities = 67/183 (36%), Positives = 85/183 (46%), Gaps = 14/183 (7%)
Frame = -3

Query: 553 ERNPH--LTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQSRD---E 389
+RNP T+ D KG KSCH+ AGWN PI LV G RD
Sbjct: 457 KRNPSNAFTINDLKGKKSCHTGLGRTAGWNIPIGMLVKK----------GFINPRDCNIP 506

Query: 388 AVVSSFFSSTCAPSELAGQ---GLCTSC-----GNNGSCTSESLVYGGYSGAFRCLVDGT 233
VS FFS++C PS G LC C GNN S Y Y+GAFRCL +
Sbjct: 507 QAVSEFFSASCVPSAEQGNYPSTLCQLCIGDNNGNNKCSASSQERYYSYNGAFRCLAEDA 566

Query: 232 GDIAFVRSDTVERLSSDGKHAQEWSTKALDE-FRYLCPQGGCRSINENLGNCTFGSVPAN 56
GD+AFV+ TV ++DGK+ + W+ F+ LC + G R+ C VPA
Sbjct: 567 GDVAFVKHSTVFE-NTDGKNTESWARDLKSSGFQLLC-RNGARAEVTQFAQCHLARVPAQ 624

Query: 55 VLM 47
+M
Sbjct: 625 AIM 627



Score = 89.4 bits (220), Expect = 1e-16
Identities = 64/199 (32%), Positives = 94/199 (47%), Gaps = 14/199 (7%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDS-ELQA---- 431
T VA+V K + ++T+ KG +SCH+ AGWN P+ +L+DS L A
Sbjct: 104 TSYYAVAVVRKGS-----NITINSLKGVRSCHTGINRTAGWNVPVGYLIDSGRLPAMGCD 158

Query: 430 IPKKANGDTQSRDEAVVSSFFSSTCAPSELAGQ---GLCTSCGNNGS----CTSESLV-Y 275
+PK VS +FS++C P + LC C + S C S Y
Sbjct: 159 LPK------------AVSDYFSASCVPGTNSASYPTSLCQLCKGDSSGQNKCQGNSQEQY 206

Query: 274 GGYSGAFRCLVDGTGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSIN 98
YSGAFRCL +G G++AFV+ TV ++DG+ W+ + +F+ LC G +
Sbjct: 207 YDYSGAFRCLAEGAGEVAFVKHSTVPE-NTDGRTLSTWAQQFRSKDFQLLCRNGSTADVT 265

Query: 97 ENLGNCTFGSVPANVLMTR 41
E C VPA ++ R
Sbjct: 266 E-WRTCHLARVPARAVVVR 283


>tr|Q4ADJ7|Q4ADJ7_CHICK Ovotransferrin BB type OS=Gallus gallus
GN=TFEW PE=2 SV=1
Length = 705

Score = 94.7 bits (234), Expect = 3e-18
Identities = 64/187 (34%), Positives = 90/187 (48%), Gaps = 1/187 (0%)
Frame = -3

Query: 595 TQLEEVAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKA 416
T VA+V K T T+ D +G SCH+ +AGWN PI L+ AI +
Sbjct: 109 TSYYAVAVVKKGT-----EFTVNDLQGKTSCHTGLGRSAGWNIPIGTLIHRG--AI--EW 159

Query: 415 NGDTQSRDEAVVSSFFSSTCAPSELAGQGLCTSC-GNNGSCTSESLVYGGYSGAFRCLVD 239
G E V+ FFS++C P Q LC C G+ + + + Y GYSGAF CL D
Sbjct: 160 EGIESGSVEQAVAKFFSASCVPGATIEQKLCRQCKGDPKTKCARNAPYSGYSGAFHCLKD 219

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTKALDEFRYLCPQGGCRSINENLGNCTFGSVPA 59
G GD+AFV+ TV + D K DE+ LC G + + +N C + V A
Sbjct: 220 GKGDVAFVKHTTVNENAPDQK----------DEYELLCLDGSRQPV-DNYKTCNWARVAA 268

Query: 58 NVLMTRN 38
+ ++ R+
Sbjct: 269 HAVVARD 275



Score = 80.9 bits (198), Expect = 5e-14
Identities = 58/195 (29%), Positives = 91/195 (46%), Gaps = 7/195 (3%)
Frame = -3

Query: 580 VAIVNKETCERNPHLTLKDFKGAKSCHSDHLTAAGWNYPIQFLVDSELQAIPKKANGDTQ 401
VA+ K++ ++ + KG KSCH+ AGW P+ + + T
Sbjct: 453 VAVARKDS-----NVNWNNLKGKKSCHTAVGRTAGWVIPMGLIHNRT----------GTC 497

Query: 400 SRDEAVVSSFFSSTCAPSELAGQGLCTSCGNNGSCTSESLV------YGGYSGAFRCLVD 239
+ DE +FS CAP LC C +G E V Y GY+GA RCLV+
Sbjct: 498 NFDE-----YFSEGCAPGSPPNSRLCQLCQGSGGIPPEKCVASSHEKYFGYTGALRCLVE 552

Query: 238 GTGDIAFVRSDTVERLSSDGKHAQEWSTK-ALDEFRYLCPQGGCRSINENLGNCTFGSVP 62
GD+AF++ TVE ++ GK+ +W+ +D+F LC G ++ + C VP
Sbjct: 553 -KGDVAFIQHSTVEE-NTGGKNKADWAKNLQMDDFELLCTDGRRANVMD-YRECNLAEVP 609

Query: 61 ANVLMTRNAQSNKRR 17
+ ++ R ++NK R
Sbjct: 610 THAVVVRPEKANKIR 624