BP920375
Clone id YMU001_000136_D04
Library
Length 510
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTCCATGGACAAAAAGGGTGATATCAGGATTGAAATCAACACCAAAACATTCCCTGAAAG
CACCTTTTGAAGGTAAAGCGTGATTGAGAAGCATGTCATCATTGTCCGACATTGTTTGCA
GACCTTCTGAATATCTCAAGTTTGATTTTGAGCTCAGAAAAAGCTCTCGCAGAGCCCTCG
GTAATGGATCCAGAGGTGGAGGCCTGGCTTCAAAGGCCTTGAGCAGTTCCCGGACCCGTA
GATTCAGAGCAGCATAATGGCAGCGATCGCCATCAAATGTATTTTCACTACATATGGCTC
CACATTCCATTAGTATACGGGCAGCATCCAAATGGCCCGCTAGGCATGCATAGTATAGCG
CGACTGAGTCCCACGCATCCCTTACATTCACATTCACACCTCCTTCCAGAAGGATGTTGA
GCCTCTCAATGTCTCCTGCTCTTGCTGCCTCGTAAATGTCTCCCGAGGGCACCGTCTTAC
GAGGAAGAGGAGGTTCTTCAGGCTCATCTG
■■Homology search results ■■ -
sp_hit_id Q5XIU1
Definition sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus
Align length 86
Score (bit) 87.0
E-value 5.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920375|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_D04.
(510 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing... 87 5e-17
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containi... 87 5e-17
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containi... 84 3e-16
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W O... 64 5e-10
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schi... 63 9e-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 1... 47 4e-05
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 1... 47 4e-05
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidops... 47 7e-05
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase, H3 lys... 46 9e-05
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing pr... 46 9e-05
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 reg... 46 1e-04
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1... 46 1e-04
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase, H3 lys... 45 2e-04
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2... 45 2e-04
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 reg... 45 2e-04
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 1... 45 2e-04
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 O... 45 2e-04
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1... 45 2e-04
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN... 45 3e-04
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 O... 45 3e-04
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing pr... 45 3e-04
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 reg... 44 3e-04
sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 ... 44 3e-04
sp|Q6S5J6|KRIT1_MOUSE Krev interaction trapped protein 1 OS=Mus ... 44 4e-04
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 4... 44 4e-04
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing p... 44 4e-04
sp|Q6TNJ1|KRIT1_BOVIN Krev interaction trapped protein 1 OS=Bos ... 44 6e-04
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mu... 44 6e-04
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1... 44 6e-04
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Or... 43 8e-04

>sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing
protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1
Length = 478

Score = 87.0 bits (214), Expect = 5e-17
Identities = 42/86 (48%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAIC 290
+ D++ + R GD+ R+ LLE V VNVRD WDS LYYACL GH + R L+ GA C
Sbjct: 3 TSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVRYLLANGARC 62

Query: 289 SENTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y AL+ +R L+ +
Sbjct: 63 EANTFDGERCLYGALSDPIRRALRDY 88


>sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing
protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1
Length = 478

Score = 87.0 bits (214), Expect = 5e-17
Identities = 42/86 (48%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAIC 290
+ D++ + R GD+ R+ LLE V VNVRD WDS LYYACL GH + R L+ GA C
Sbjct: 3 TSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVRYLLANGARC 62

Query: 289 SENTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y AL+ +R L+ +
Sbjct: 63 EANTFDGERCLYGALSDPIRRALRDY 88


>sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing
protein 1 OS=Homo sapiens GN=ABTB1 PE=2 SV=1
Length = 478

Score = 84.3 bits (207), Expect = 3e-16
Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 1/86 (1%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAIC 290
+ D++ + R GD+ R+ LLE V VNVRD WDS LYYACL GH + L+ GA C
Sbjct: 3 TSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARC 62

Query: 289 SENTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y AL+ +R L+ +
Sbjct: 63 EANTFDGERCLYGALSDPIRRALRDY 88


>sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W
OS=Saccharomyces cerevisiae GN=YIL001W PE=1 SV=1
Length = 513

Score = 63.5 bits (153), Expect = 5e-10
Identities = 28/79 (35%), Positives = 49/79 (62%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSENTFDG 269
+ R GD++ ++ L+ GVNVN D +D+ L+ A L GH ++L++ GA+C + ++G
Sbjct: 16 SCRTGDMDNVDRLISTGVNVNSVDKFDNSPLFLASLCGHEAVVKLLLQRGAVCDRDRYEG 75

Query: 268 DRCHYAALNLRVRELLKAF 212
RC Y AL +R+ L ++
Sbjct: 76 ARCIYGALTDTIRDTLLSY 94


>sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3
OS=Schizosaccharomyces pombe GN=btb3 PE=1 SV=1
Length = 523

Score = 62.8 bits (151), Expect = 9e-10
Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
Frame = -3

Query: 460 DIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSE 284
++ EA R GD+E + L+E +N D +D L A L GH + L+E GA+C
Sbjct: 55 ELCEACRRGDLEVVKSLVENYNTPINQVDQFDYSPLVLASLCGHEPVVKFLLENGALCER 114

Query: 283 NTFDGDRCHYAALNLRVRELLKAF 212
+TF G+RC Y ALN +R +L ++
Sbjct: 115 DTFQGERCLYGALNDNIRRMLLSY 138


>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17
OS=Mus musculus GN=Ankrd17 PE=1 SV=2
Length = 2603

Score = 47.4 bits (111), Expect = 4e-05
Identities = 24/57 (42%), Positives = 32/57 (56%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
S + EAA+ G +E + LL G NV+ A AL YAC GH D A +L++ GA
Sbjct: 561 STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGA 617



Score = 43.1 bits (100), Expect = 8e-04
Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGAICSEN 281
+ EA AG +E +LLE G +N + + AL AC GHL+ R L+E GA
Sbjct: 367 LMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHK 426

Query: 280 TFDGDRCHYAAL 245
T D H A +
Sbjct: 427 T---DEMHTALM 435



Score = 37.0 bits (84), Expect = 0.054
Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGA 296
+ EAAR G E + +LL G N+N + + AL AC G L+ A L++ GA
Sbjct: 500 LMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGA 554



Score = 36.6 bits (83), Expect = 0.070
Identities = 18/51 (35%), Positives = 28/51 (54%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G +E + LLE G + + AL AC+ GH++ AR+L++ GA
Sbjct: 404 ACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA 454



Score = 36.6 bits (83), Expect = 0.070
Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVRDAW-DSVALYYACLAGHLDAARILMECGAICSEN 281
+ +AARAG + + L+ G NVN A D L AC GHL +L+ GA +
Sbjct: 630 LMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHR 689

Query: 280 TFDG 269
DG
Sbjct: 690 LKDG 693



Score = 33.5 bits (75), Expect = 0.59
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G ++ + +LLE G ++ + L A AGH++ AR+L+E GA
Sbjct: 337 ACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGA 387



Score = 32.0 bits (71), Expect = 1.7
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G E + LLE G ++ RD L A AGH+ IL++ GA
Sbjct: 1086 ACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGA 1136



Score = 31.6 bits (70), Expect = 2.3
Identities = 19/62 (30%), Positives = 28/62 (45%)
Frame = -3

Query: 451 EAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSENTFD 272
EA GD+ + LL G +VN L AC AG+ + A++L+ A +
Sbjct: 236 EACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIK 295

Query: 271 GD 266
GD
Sbjct: 296 GD 297


>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17
OS=Homo sapiens GN=ANKRD17 PE=1 SV=3
Length = 2603

Score = 47.4 bits (111), Expect = 4e-05
Identities = 24/57 (42%), Positives = 32/57 (56%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
S + EAA+ G +E + LL G NV+ A AL YAC GH D A +L++ GA
Sbjct: 565 STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGA 621



Score = 43.1 bits (100), Expect = 8e-04
Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGAICSEN 281
+ EA AG +E +LLE G +N + + AL AC GHL+ R L+E GA
Sbjct: 371 LMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHK 430

Query: 280 TFDGDRCHYAAL 245
T D H A +
Sbjct: 431 T---DEMHTALM 439



Score = 37.0 bits (84), Expect = 0.054
Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGA 296
+ EAAR G E + +LL G N+N + + AL AC G L+ A L++ GA
Sbjct: 504 LMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGA 558



Score = 36.6 bits (83), Expect = 0.070
Identities = 18/51 (35%), Positives = 28/51 (54%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G +E + LLE G + + AL AC+ GH++ AR+L++ GA
Sbjct: 408 ACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA 458



Score = 36.6 bits (83), Expect = 0.070
Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVRDAW-DSVALYYACLAGHLDAARILMECGAICSEN 281
+ +AARAG + + L+ G NVN A D L AC GHL +L+ GA +
Sbjct: 634 LMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHR 693

Query: 280 TFDG 269
DG
Sbjct: 694 LKDG 697



Score = 33.5 bits (75), Expect = 0.59
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G ++ + +LLE G ++ + L A AGH++ AR+L+E GA
Sbjct: 341 ACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGA 391



Score = 32.0 bits (71), Expect = 1.7
Identities = 18/51 (35%), Positives = 24/51 (47%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G E + LLE G ++ RD L A AGH+ IL++ GA
Sbjct: 1090 ACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGA 1140



Score = 31.6 bits (70), Expect = 2.3
Identities = 19/62 (30%), Positives = 28/62 (45%)
Frame = -3

Query: 451 EAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSENTFD 272
EA GD+ + LL G +VN L AC AG+ + A++L+ A +
Sbjct: 240 EACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIK 299

Query: 271 GD 266
GD
Sbjct: 300 GD 301


>sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis
thaliana GN=KEG PE=1 SV=2
Length = 1625

Score = 46.6 bits (109), Expect = 7e-05
Identities = 20/70 (28%), Positives = 40/70 (57%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSENT 278
++ AA A ++E + ++L+ GVN N+R+ +++ L+ A G +L+E G+ C+
Sbjct: 730 LHTAAMANNVELVRVILDAGVNANIRNVHNTIPLHMALARGANSCVSLLLESGSDCNIQD 789

Query: 277 FDGDRCHYAA 248
+GD + A
Sbjct: 790 DEGDNAFHIA 799


>sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase, H3
lysine-9 specific 3 OS=Mus musculus GN=Ehmt2 PE=1 SV=2
Length = 1263

Score = 46.2 bits (108), Expect = 9e-05
Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSENT 278
++ AA+ G +E ++LL+ G N+N D L A + HL+ AR +++ G
Sbjct: 742 LHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKE 801

Query: 277 FDGDRC-HYAAL--NLRVRELL 221
DG C H+AA NL + LL
Sbjct: 802 EDGSTCLHHAAKIGNLEMVSLL 823


>sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing
protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1
Length = 2542

Score = 46.2 bits (108), Expect = 9e-05
Identities = 23/57 (40%), Positives = 32/57 (56%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
S + EA++ G +E + LL G NV+ A AL YAC GH D A +L++ GA
Sbjct: 536 STPLMEASQEGHLELVKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGA 592



Score = 44.7 bits (104), Expect = 3e-04
Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGAICSEN 281
+ EAA AG +E +LL+ G +N + + AL AC GHLD R L+E GA
Sbjct: 342 LMEAASAGHVEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEHK 401

Query: 280 TFDGDRCHYAAL 245
T D H A +
Sbjct: 402 T---DEMHTALM 410



Score = 35.4 bits (80), Expect = 0.16
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G ++ + LLE G + + AL AC+ GH++ AR+L++ GA
Sbjct: 379 ACYKGHLDMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGA 429



Score = 35.0 bits (79), Expect = 0.20
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVR-DAWDSVALYYACLAGHLDAARILMECGA 296
+ EAAR G E + +LL G N+N + + AL AC G + A L++ GA
Sbjct: 475 LMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSEVADFLIKAGA 529



Score = 35.0 bits (79), Expect = 0.20
Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
Frame = -3

Query: 457 IYEAARAGDIERLNILLEGGVNVNVRDA-WDSVALYYACLAGHLDAARILMECGAICSEN 281
+ +AARAG + + L+ G NVN A D + AC GHL +L+ GA +
Sbjct: 605 LMKAARAGHLCTVQFLISKGANVNRATANNDHTVVSLACAGGHLAVVELLLAHGADPTHR 664

Query: 280 TFDG 269
DG
Sbjct: 665 LKDG 668



Score = 33.1 bits (74), Expect = 0.78
Identities = 16/51 (31%), Positives = 27/51 (52%)
Frame = -3

Query: 448 AARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGA 296
A G ++ + +LL G N+ + L A AGH++ AR+L++ GA
Sbjct: 312 ACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGHVEVARVLLDHGA 362



Score = 32.7 bits (73), Expect = 1.0
Identities = 20/69 (28%), Positives = 32/69 (46%)
Frame = -3

Query: 472 VPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAI 293
V + + EA GD+ + LL+ G +VN L AC AG+ + A++L+ A
Sbjct: 204 VDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHAN 263

Query: 292 CSENTFDGD 266
+ GD
Sbjct: 264 VEDRGNKGD 272


tr_hit_id A9SM44
Definition tr|A9SM44|A9SM44_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 129
Score (bit) 182.0
E-value 8.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920375|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_D04.
(510 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SM44|A9SM44_PHYPA Predicted protein OS=Physcomitrella paten... 182 8e-45
tr|A7PX20|A7PX20_VITVI Chromosome chr12 scaffold_36, whole genom... 170 3e-41
tr|A5C3Z2|A5C3Z2_VITVI Putative uncharacterized protein OS=Vitis... 167 2e-40
tr|Q9SJ85|Q9SJ85_ARATH Putative uncharacterized protein At2g0474... 158 2e-37
tr|Q5ZAA9|Q5ZAA9_ORYSJ Os06g0318200 protein OS=Oryza sativa subs... 157 4e-37
tr|B8B143|B8B143_ORYSI Putative uncharacterized protein OS=Oryza... 152 7e-36
tr|Q5ZKS9|Q5ZKS9_CHICK Putative uncharacterized protein OS=Gallu... 92 2e-17
tr|B6P0Y9|B6P0Y9_BRAFL Putative uncharacterized protein OS=Branc... 91 4e-17
tr|A7RTA9|A7RTA9_NEMVE Predicted protein OS=Nematostella vectens... 89 2e-16
tr|Q6INV0|Q6INV0_XENLA Abtb1 protein OS=Xenopus laevis GN=abtb1 ... 88 3e-16
tr|A4IHP2|A4IHP2_XENTR Abtb1 protein OS=Xenopus tropicalis GN=ab... 88 3e-16
tr|B3RN40|B3RN40_TRIAD Putative uncharacterized protein OS=Trich... 85 2e-15
tr|B6LGN1|B6LGN1_BRAFL Putative uncharacterized protein OS=Branc... 84 4e-15
tr|A4FV83|A4FV83_BOVIN ABTB1 protein OS=Bos taurus GN=ABTB1 PE=2... 82 1e-14
tr|Q4RJY8|Q4RJY8_TETNG Chromosome 9 SCAF15033, whole genome shot... 81 3e-14
tr|A1CMQ3|A1CMQ3_ASPCL Ankyrin repeat and BTB/POZ domain protein... 80 4e-14
tr|Q4WCW7|Q4WCW7_ASPFU Ankyrin repeat and BTB/POZ domain protein... 79 1e-13
tr|Q2KF72|Q2KF72_MAGGR Putative uncharacterized protein OS=Magna... 79 1e-13
tr|B0YDH8|B0YDH8_ASPFC Ankyrin repeat and BTB/POZ domain protein... 79 1e-13
tr|A4RB24|A4RB24_MAGGR Putative uncharacterized protein OS=Magna... 79 1e-13
tr|A1DL90|A1DL90_NEOFI Ankyrin repeat and BTB/POZ domain protein... 79 1e-13
tr|B6QH38|B6QH38_PENMA Ankyrin repeat and BTB/POZ domain protein... 78 2e-13
tr|B2W6D7|B2W6D7_PYRTR Ankyrin repeat and BTB/POZ domain-contain... 78 3e-13
tr|A6R5Z7|A6R5Z7_AJECN Predicted protein OS=Ajellomyces capsulat... 78 3e-13
tr|Q1DI13|Q1DI13_COCIM Putative uncharacterized protein OS=Cocci... 77 4e-13
tr|Q2U6P4|Q2U6P4_ASPOR Ankyrin repeat protein OS=Aspergillus ory... 76 8e-13
tr|B8NKI0|B8NKI0_ASPFL Ankyrin repeat and BTB/POZ domain protein... 76 8e-13
tr|B8MKY1|B8MKY1_9EURO Ankyrin repeat and BTB/POZ domain protein... 75 1e-12
tr|A2R0C3|A2R0C3_ASPNC Contig An12c0270, complete genome OS=Aspe... 75 2e-12
tr|B6HQ52|B6HQ52_PENCH Pc22g24050 protein OS=Penicillium chrysog... 75 2e-12

>tr|A9SM44|A9SM44_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_165660 PE=4 SV=1
Length = 636

Score = 182 bits (462), Expect = 8e-45
Identities = 90/129 (69%), Positives = 101/129 (78%)
Frame = -3

Query: 508 DEPEEPPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHL 329
DEPEEP LPRK VP GDIYEA+RAGD++RL +LL+ GVNVN RD WDSVALYYACLAGHL
Sbjct: 18 DEPEEPALPRKKVPMGDIYEASRAGDVDRLKLLLDEGVNVNARDNWDSVALYYACLAGHL 77

Query: 328 DAARILMECGAICSENTFDGDRCHYAALNLRVRELLKAFXXXXXXXXXXXXXXXXLFLSS 149
DAARIL+E GAICSENTFDGDRCHYA+LNL+VR LLKAF LF+S
Sbjct: 78 DAARILLEKGAICSENTFDGDRCHYASLNLQVRRLLKAFEARPPPLDPLPRTFRELFVSF 137

Query: 148 KSNLRYSEG 122
++N RY EG
Sbjct: 138 EANCRYLEG 146


>tr|A7PX20|A7PX20_VITVI Chromosome chr12 scaffold_36, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025867001
PE=4 SV=1
Length = 548

Score = 170 bits (431), Expect = 3e-41
Identities = 91/170 (53%), Positives = 108/170 (63%), Gaps = 2/170 (1%)
Frame = -3

Query: 505 EPEE--PPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGH 332
EPE+ LP K VP+GD++EA+RAGD++RL LLE GVNVN RD WDSVALYYACLAGH
Sbjct: 20 EPEDFAASLPIKKVPAGDVFEASRAGDVDRLRYLLESGVNVNARDQWDSVALYYACLAGH 79

Query: 331 LDAARILMECGAICSENTFDGDRCHYAALNLRVRELLKAFXXXXXXXXXXXXXXXXLFLS 152
LDAAR+L+E GAICSE+TFDGDRCHYAALNL+VR+LLKAF FL
Sbjct: 80 LDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAFEARPPPLGPLQGALRETFLG 139

Query: 151 SKSNLRYSEGLQTMSDNDDMLLNHALPSKGAFRECFGVDFNPDITLFVHG 2
+N YSE L+ N + N L F PD+ +V G
Sbjct: 140 CAANRIYSEELEGQFQNSGLSSNGGLNRD---------HFPPDVAFYVQG 180


>tr|A5C3Z2|A5C3Z2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004051 PE=4 SV=1
Length = 190

Score = 167 bits (424), Expect = 2e-40
Identities = 85/139 (61%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
Frame = -3

Query: 505 EPEE--PPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGH 332
EPE+ LP K VP+GD++EA+RAGD++RL LLE GVNVN RD WDSVALYYACLAGH
Sbjct: 20 EPEDFAASLPIKKVPAGDVFEASRAGDVDRLRYLLESGVNVNARDQWDSVALYYACLAGH 79

Query: 331 LDAARILMECGAICSENTFDGDRCHYAALNLRVRELLKAFXXXXXXXXXXXXXXXXLFLS 152
LDAAR+L+E GAICSE+TFDGDRCHYAALNL+VR+LLKAF FL
Sbjct: 80 LDAARMLLESGAICSEHTFDGDRCHYAALNLKVRKLLKAFEARPPPLGPLQGALRETFLG 139

Query: 151 SKSNLRYSEGLQTMSDNDD 95
+N YSE L+ N D
Sbjct: 140 CAANRIYSEELEGQFQNSD 158


>tr|Q9SJ85|Q9SJ85_ARATH Putative uncharacterized protein At2g04740
OS=Arabidopsis thaliana GN=At2g04740 PE=2 SV=1
Length = 499

Score = 158 bits (399), Expect = 2e-37
Identities = 82/165 (49%), Positives = 103/165 (62%)
Frame = -3

Query: 496 EPPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLDAAR 317
+P +P K VP+GDI+EA+RAGD++RL L+E GVNVN RD WDSVALYYACLAGH+D+AR
Sbjct: 27 KPSVPLKKVPNGDIFEASRAGDVDRLRYLVETGVNVNARDRWDSVALYYACLAGHIDSAR 86

Query: 316 ILMECGAICSENTFDGDRCHYAALNLRVRELLKAFXXXXXXXXXXXXXXXXLFLSSKSNL 137
+L+E GAICSE+TFDGDRCHYA+LNLR+R+LLKAF FL N
Sbjct: 87 LLLENGAICSEHTFDGDRCHYASLNLRIRKLLKAFEARPPPLAPLQASLRDTFLGCCHNR 146

Query: 136 RYSEGLQTMSDNDDMLLNHALPSKGAFRECFGVDFNPDITLFVHG 2
Y + + D D L + F PD+ +V G
Sbjct: 147 DYLQQEEANLDVSDTLSEFGSSNY----------FPPDVMFYVQG 181


>tr|Q5ZAA9|Q5ZAA9_ORYSJ Os06g0318200 protein OS=Oryza sativa subsp.
japonica GN=P0468A12.26 PE=2 SV=1
Length = 585

Score = 157 bits (396), Expect = 4e-37
Identities = 86/169 (50%), Positives = 104/169 (61%), Gaps = 1/169 (0%)
Frame = -3

Query: 505 EPEEPPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLD 326
E +P +P K VP+GD++EAARAGD RL +LL GG NVN RD WDSVALYYACLAGH D
Sbjct: 27 EDLQPSVPLKKVPAGDLFEAARAGDCARLALLLGGGANVNERDRWDSVALYYACLAGHAD 86

Query: 325 AARILMECGAICSENTFDGDRCHYAALNLRVRELLKAFXXXXXXXXXXXXXXXXLFLSSK 146
AAR+L+E GA+C+E TFDGDRCHYAALNLR+R LLKAF FL+
Sbjct: 87 AARMLLEAGAVCAERTFDGDRCHYAALNLRLRRLLKAFEARPPPLPPLPAALRATFLACP 146

Query: 145 SN-LRYSEGLQTMSDNDDMLLNHALPSKGAFRECFGVDFNPDITLFVHG 2
+N + E LQ + ++ L A F PDIT +V G
Sbjct: 147 ANRAAFLEMLQWTAGSEAAALAAAAGFGPTDNPSSTSLFPPDITFYVDG 195


>tr|B8B143|B8B143_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_22737 PE=4 SV=1
Length = 181

Score = 152 bits (385), Expect = 7e-36
Identities = 71/98 (72%), Positives = 82/98 (83%)
Frame = -3

Query: 505 EPEEPPLPRKTVPSGDIYEAARAGDIERLNILLEGGVNVNVRDAWDSVALYYACLAGHLD 326
E +P +P K VP+GD++EAARAGD RL +LL GG NVN RD WDSVALYYACLAGH D
Sbjct: 27 EDLQPSVPLKKVPAGDLFEAARAGDCARLALLLGGGANVNERDRWDSVALYYACLAGHAD 86

Query: 325 AARILMECGAICSENTFDGDRCHYAALNLRVRELLKAF 212
AAR+L+E GA+C+E TFDGDRCHYAALNLR+R LLKAF
Sbjct: 87 AARMLLEAGAVCAERTFDGDRCHYAALNLRLRRLLKAF 124


>tr|Q5ZKS9|Q5ZKS9_CHICK Putative uncharacterized protein OS=Gallus
gallus GN=RCJMB04_9f7 PE=2 SV=1
Length = 477

Score = 91.7 bits (226), Expect = 2e-17
Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAIC 290
+ D++ + + GD+ R+ LLE V +NVRD WDS LYYACL GH D R L+ GA C
Sbjct: 3 TNDLFTSCKKGDVSRVRYLLEQRDVEINVRDKWDSTPLYYACLCGHEDLVRYLLANGAKC 62

Query: 289 SENTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y AL+ +R LLK +
Sbjct: 63 EANTFDGERCLYGALSDAIRRLLKEY 88


>tr|B6P0Y9|B6P0Y9_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_270071 PE=4 SV=1
Length = 486

Score = 90.5 bits (223), Expect = 4e-17
Identities = 43/84 (51%), Positives = 57/84 (67%), Gaps = 1/84 (1%)
Frame = -3

Query: 460 DIYEAARAGDIERLNILLEGG-VNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSE 284
+++ A R GD+ R+ L+E V++NVRD WDS LYYACL GH D L++ GA C
Sbjct: 5 ELFLACRKGDLSRVKHLVEQKEVDLNVRDRWDSTPLYYACLCGHEDLVEYLLDKGARCEA 64

Query: 283 NTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y ALN R+R +LK +
Sbjct: 65 NTFDGERCLYGALNDRIRNMLKNY 88


>tr|A7RTA9|A7RTA9_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g201827 PE=4 SV=1
Length = 491

Score = 88.6 bits (218), Expect = 2e-16
Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
Frame = -3

Query: 460 DIYEAARAGDIERL-NILLEGGVNVNVRDAWDSVALYYACLAGHLDAARILMECGAICSE 284
D++ R GD+E N++ E V+VNVRD WDS LYYACL GH L+ GA C
Sbjct: 5 DLFHFCRIGDVENTRNLVEEEDVDVNVRDCWDSTPLYYACLCGHEALVAYLLSIGARCEP 64

Query: 283 NTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC YAAL R+R++L+ +
Sbjct: 65 NTFDGERCLYAALTDRIRKILQNY 88


>tr|Q6INV0|Q6INV0_XENLA Abtb1 protein OS=Xenopus laevis GN=abtb1
PE=2 SV=1
Length = 477

Score = 87.8 bits (216), Expect = 3e-16
Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
Frame = -3

Query: 466 SGDIYEAARAGDIERLNILLEG-GVNVNVRDAWDSVALYYACLAGHLDAARILMECGAIC 290
+ D++ + R GDI R+ L+E V +NVRD WDS LYYACL GH + R L+ GA C
Sbjct: 3 TSDLFSSCRKGDIFRVRHLVEQRDVELNVRDKWDSTPLYYACLCGHEELVRYLLANGAKC 62

Query: 289 SENTFDGDRCHYAALNLRVRELLKAF 212
NTFDG+RC Y AL+ +R LLK +
Sbjct: 63 EVNTFDGERCLYGALSDTIRRLLKEY 88