BP920377
Clone id YMU001_000136_D07
Library
Length 474
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTGGATAACCATGAAAATCTGTATTTTGAAAATGCAGGCAGCCTTAACAAATAA
ATATCAACGCGACTGATACCATAACAGCTACAACAAACTCTCCAAAAAAAGAACGACAAG
TCCAGCAAATTCATCCTTAATAAGGGAGCATATGGTAAGTGAGTTGAAAGAGTGGCATAA
TTTCCTTCAAGCTGCAGCAACAATGGGTATGCTCCCTTGTTTCTGCAAGGGTTCCACTGG
ACCTGTAGCTGTGGCTGGGGTGGCTGCTGGGTCAGCAGGTTTCACATCAGAACCCTCTGC
ACCCGGCGCCGCCGCCGCCGCCGGAGGTGCGGGTGGCGGAGCCTTCATATGAGCAGGTGG
ATTGTGCTTCAGCTTCACCAAGACCTGCCTCATACGAGTAAGGTCTGTCACCTTTCCTGT
CTTGGGGCCATGGTTGAACACAACAGAGGGCTTTTTCTTATCCTTATTGCCTCT
■■Homology search results ■■ -
sp_hit_id Q25464
Definition sp|Q25464|FP2_MYTGA Adhesive plaque matrix protein 2 OS=Mytilus galloprovincialis
Align length 50
Score (bit) 33.9
E-value 0.38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920377|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_D07.
(474 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q25464|FP2_MYTGA Adhesive plaque matrix protein 2 OS=Mytilus ... 34 0.38
sp|Q9WTS6|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Odz3 PE=2 SV=1 33 0.85
sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 33 0.85
sp|Q3UHK6|TEN4_MOUSE Teneurin-4 OS=Mus musculus GN=Odz4 PE=2 SV=2 32 1.5
sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 32 1.5
sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=odz3 PE=2 SV=1 31 3.2
sp|Q9WTS4|TEN1_MOUSE Teneurin-1 OS=Mus musculus GN=Odz1 PE=1 SV=1 29 9.4
sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 29 9.4
sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=ODZ1 PE=2 SV=1 29 9.4
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 O... 29 9.4

>sp|Q25464|FP2_MYTGA Adhesive plaque matrix protein 2 OS=Mytilus
galloprovincialis GN=FP2 PE=2 SV=1
Length = 473

Score = 33.9 bits (76), Expect = 0.38
Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
Frame = +1

Query: 118 KSSKFILNKGAYGK*VERVA*FPSSCSNNGY-APLFLQGFHWTCSCGWGG 264
K+ K + G +G+ E+ P+ C NNG +PL G+ TCS G+ G
Sbjct: 102 KTFKCVCRNGNFGRLCEKNVCSPNPCKNNGKCSPLGKTGYKCTCSGGYTG 151


>sp|Q9WTS6|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Odz3 PE=2 SV=1
Length = 2715

Score = 32.7 bits (73), Expect = 0.85
Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGW--GGCWVSRFHIRTLCT 303
P C++NG L G+H C GW GC V+ + TLCT
Sbjct: 753 PGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVA---METLCT 791


>sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3
Length = 2699

Score = 32.7 bits (73), Expect = 0.85
Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGW--GGCWVSRFHIRTLCT 303
P C++NG L G+H C GW GC V+ + TLCT
Sbjct: 744 PGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVA---METLCT 782


>sp|Q3UHK6|TEN4_MOUSE Teneurin-4 OS=Mus musculus GN=Odz4 PE=2 SV=2
Length = 2771

Score = 32.0 bits (71), Expect = 1.5
Identities = 12/27 (44%), Positives = 14/27 (51%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P C+ NG L L G+H C GW G
Sbjct: 803 PGLCNGNGRCTLDLNGWHCVCQLGWRG 829


>sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2
Length = 2769

Score = 32.0 bits (71), Expect = 1.5
Identities = 12/27 (44%), Positives = 14/27 (51%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P C+ NG L L G+H C GW G
Sbjct: 801 PGLCNGNGRCTLDLNGWHCVCQLGWRG 827


>sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=odz3 PE=2 SV=1
Length = 2590

Score = 30.8 bits (68), Expect = 3.2
Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGW--GGCWVSRFHIRTLC 300
P C++NG L G+H C GW GC V+ + TLC
Sbjct: 634 PGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVA---METLC 671


>sp|Q9WTS4|TEN1_MOUSE Teneurin-1 OS=Mus musculus GN=Odz1 PE=1 SV=1
Length = 2731

Score = 29.3 bits (64), Expect = 9.4
Identities = 11/27 (40%), Positives = 12/27 (44%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P C NG L G+H C GW G
Sbjct: 765 PGLCFGNGRCTLDQNGWHCVCQVGWSG 791


>sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2
Length = 2725

Score = 29.3 bits (64), Expect = 9.4
Identities = 11/27 (40%), Positives = 12/27 (44%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P C NG L G+H C GW G
Sbjct: 766 PGLCFGNGRCTLDQNGWHCVCQVGWSG 792


>sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=ODZ1 PE=2 SV=1
Length = 2705

Score = 29.3 bits (64), Expect = 9.4
Identities = 11/27 (40%), Positives = 12/27 (44%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P C NG L G+H C GW G
Sbjct: 739 PGLCYGNGRCTLDQNGWHCVCQVGWSG 765


>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1
OS=Danio rerio GN=notch1a PE=2 SV=1
Length = 2437

Score = 29.3 bits (64), Expect = 9.4
Identities = 11/27 (40%), Positives = 14/27 (51%)
Frame = +1

Query: 184 PSSCSNNGYAPLFLQGFHWTCSCGWGG 264
P++C N G + GFH C GW G
Sbjct: 302 PNACQNGGTCHNTIGGFHCVCVNGWTG 328


tr_hit_id B8LRT8
Definition tr|B8LRT8|B8LRT8_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 36
Score (bit) 61.6
E-value 2.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920377|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_D07.
(474 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LRT8|B8LRT8_PICSI Putative uncharacterized protein OS=Picea... 62 2e-08
tr|A7Q3F1|A7Q3F1_VITVI Chromosome chr13 scaffold_48, whole genom... 56 1e-06
tr|A5B4U6|A5B4U6_VITVI Putative uncharacterized protein OS=Vitis... 56 1e-06
tr|Q7XKE9|Q7XKE9_ORYSJ Os04g0679100 protein OS=Oryza sativa subs... 55 2e-06
tr|Q259D4|Q259D4_ORYSA H0801D08.11 protein OS=Oryza sativa GN=H0... 55 2e-06
tr|A2XZ05|A2XZ05_ORYSI Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|Q8L9R8|Q8L9R8_ARATH Putative uncharacterized protein OS=Arabi... 54 4e-06
tr|O04209|O04209_ARATH Expressed protein (Putative uncharacteriz... 54 4e-06
tr|Q0VJA2|Q0VJA2_PLAAC Putative uncharacterized protein (Fragmen... 53 9e-06
tr|B4FJF0|B4FJF0_MAIZE Putative uncharacterized protein OS=Zea m... 53 9e-06
tr|B7FKY8|B7FKY8_MEDTR Putative uncharacterized protein (Fragmen... 52 1e-05
tr|A9PEB0|A9PEB0_POPTR Putative uncharacterized protein OS=Popul... 52 2e-05
tr|A6N039|A6N039_ORYSI Putative uncharacterized protein (Fragmen... 50 4e-05
tr|A5BXH1|A5BXH1_VITVI Putative uncharacterized protein OS=Vitis... 50 4e-05
tr|Q8L8Y7|Q8L8Y7_ARATH Putative uncharacterized protein OS=Arabi... 49 1e-04
tr|O65024|O65024_ARATH Putative uncharacterized protein OS=Arabi... 49 1e-04
tr|Q5Z402|Q5Z402_ORYSJ Os06g0731800 protein OS=Oryza sativa subs... 49 1e-04
tr|A3BFN9|A3BFN9_ORYSJ Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|B4FIZ5|B4FIZ5_MAIZE Putative uncharacterized protein OS=Zea m... 48 2e-04
tr|A9PA40|A9PA40_POPTR Putative uncharacterized protein OS=Popul... 48 3e-04
tr|Q9SKU1|Q9SKU1_ARATH Expressed protein (At2g20760) (At2g20760/... 46 8e-04
tr|Q8LG44|Q8LG44_ARATH Putative uncharacterized protein OS=Arabi... 46 8e-04
tr|A2YL02|A2YL02_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A9RIQ2|A9RIQ2_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.004
tr|A9RIQ1|A9RIQ1_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.004
tr|A9SK72|A9SK72_PHYPA Predicted protein (Fragment) OS=Physcomit... 44 0.005
tr|Q6Z3A8|Q6Z3A8_ORYSJ Putative uncharacterized protein P0038F09... 42 0.015
tr|A6N190|A6N190_ORYSI Putative uncharacterized protein (Fragmen... 40 0.044
tr|Q4SZV7|Q4SZV7_TETNG Chromosome undetermined SCAF11464, whole ... 35 1.4
tr|A7PP35|A7PP35_VITVI Chromosome chr8 scaffold_23, whole genome... 35 1.9

>tr|B8LRT8|B8LRT8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 354

Score = 61.6 bits (148), Expect = 2e-08
Identities = 27/36 (75%), Positives = 32/36 (88%)
Frame = -1

Query: 468 NKDKKKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
+KDKKKPS+V N GPK GK TDL+RMRQ+L+KLKHN
Sbjct: 258 DKDKKKPSIVVNQGPKPGKPTDLSRMRQILLKLKHN 293


>tr|A7Q3F1|A7Q3F1_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029265001
PE=4 SV=1
Length = 185

Score = 55.8 bits (133), Expect = 1e-06
Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
RG KD+ KKPS+V GPK GK TDL+RMRQ+L+KLKHN
Sbjct: 101 RGKKDQDKKPSIVVIQGPKPGKPTDLSRMRQILLKLKHN 139


>tr|A5B4U6|A5B4U6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_014565 PE=4 SV=1
Length = 319

Score = 55.8 bits (133), Expect = 1e-06
Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 1/39 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
RG KD+ KKPS+V GPK GK TDL+RMRQ+L+KLKHN
Sbjct: 235 RGKKDQDKKPSIVVIQGPKPGKPTDLSRMRQILLKLKHN 273


>tr|Q7XKE9|Q7XKE9_ORYSJ Os04g0679100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0017I01.5 PE=2 SV=1
Length = 301

Score = 54.7 bits (130), Expect = 2e-06
Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKH 364
RG KDK KKPS+ GPK GK TDL+RMRQ+LVKLKH
Sbjct: 203 RGKKDKDKKPSITVIQGPKPGKPTDLSRMRQILVKLKH 240


>tr|Q259D4|Q259D4_ORYSA H0801D08.11 protein OS=Oryza sativa
GN=H0801D08.11 PE=4 SV=1
Length = 301

Score = 54.7 bits (130), Expect = 2e-06
Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKH 364
RG KDK KKPS+ GPK GK TDL+RMRQ+LVKLKH
Sbjct: 203 RGKKDKDKKPSITVIQGPKPGKPTDLSRMRQILVKLKH 240


>tr|A2XZ05|A2XZ05_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_17938 PE=4 SV=1
Length = 301

Score = 54.7 bits (130), Expect = 2e-06
Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 1/38 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKH 364
RG KDK KKPS+ GPK GK TDL+RMRQ+LVKLKH
Sbjct: 203 RGKKDKDKKPSITVIQGPKPGKPTDLSRMRQILVKLKH 240


>tr|Q8L9R8|Q8L9R8_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 258

Score = 53.9 bits (128), Expect = 4e-06
Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
Frame = -1

Query: 474 RGNK---DKKKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
RG K D KKP+V GPK GK TDLTRMRQ+LVKLKHN
Sbjct: 183 RGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHN 223


>tr|O04209|O04209_ARATH Expressed protein (Putative uncharacterized
protein At2g40060) OS=Arabidopsis thaliana GN=At2g40060
PE=2 SV=1
Length = 258

Score = 53.9 bits (128), Expect = 4e-06
Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 3/41 (7%)
Frame = -1

Query: 474 RGNK---DKKKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
RG K D KKP+V GPK GK TDLTRMRQ+LVKLKHN
Sbjct: 183 RGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHN 223


>tr|Q0VJA2|Q0VJA2_PLAAC Putative uncharacterized protein (Fragment)
OS=Platanus acerifolia PE=2 SV=1
Length = 144

Score = 52.8 bits (125), Expect = 9e-06
Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 1/39 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKHN 361
RG KD+ KKPS+ GPK G+ TDL RMRQ+LVKLKHN
Sbjct: 60 RGKKDQDKKPSIAVIQGPKPGEPTDLGRMRQILVKLKHN 98


>tr|B4FJF0|B4FJF0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 305

Score = 52.8 bits (125), Expect = 9e-06
Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%)
Frame = -1

Query: 474 RGNKDK-KKPSVVFNHGPKTGKVTDLTRMRQVLVKLKH 364
RG KDK KKPS+ GPK GK TDL+RMR +LVKLKH
Sbjct: 197 RGKKDKDKKPSITVVQGPKPGKPTDLSRMRHILVKLKH 234