BP920384
Clone id YMU001_000136_E02
Library
Length 568
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACATCGTGCACCGAAATGATCCGGGCAGGCTCATTTAGACTCAGCAAATGTTGGGTGGA
CTTCATCGCCTCCTATCGTCTCGGGTAAACTTGGGCCTATCCTGGAATCACCTAGGATTT
CGATGTCGAGAGTGCATACACAGAGTCGCACTTGTTCTCGGACTTTTTCCAACCGGCAGT
GATACTTGAAGAGATCAATCAATAAACAAGTACCCAACTGGGGTACTGACAGGGGCTACT
CACTTGTGGAAGTAGCAACAGTTTTGCAGCAGTTGCAAGACGTGGACACCAATCTGGGAG
TACATTTTCAGGCAAGCAAGACAGTAGCAATAGGAATAAAAACTCTTCGTCCTTTGATTT
TGGGAAGGATGAAAACTTAAGACCAGCTGGCAGCTATAATCATGGCAGCATGCATATCAT
AGCCCTCTGCCGGCAAGGCCGGGTCGAAGAAGGATATGCACATTACAAGGAGATACAAAC
ACGAAATGAGATGCCCAACACAGAGGCGCTCTTAGAAACGGTCAGTGGCCTTGCAAGGTC
GGGAAAACTTGATGATGCGATACAAGTG
■■Homology search results ■■ -
sp_hit_id Q9LR67
Definition sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana
Align length 54
Score (bit) 41.2
E-value 0.004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920384|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E02.
(568 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein... 41 0.004
sp|Q9LSF5|PP254_ARATH Pentatricopeptide repeat-containing protei... 41 0.005
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protei... 38 0.031
sp|Q9M3A8|PP273_ARATH Pentatricopeptide repeat-containing protei... 38 0.040
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protei... 37 0.069
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protei... 36 0.12
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protei... 35 0.20
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protei... 35 0.20
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protei... 35 0.20
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protei... 35 0.34
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protei... 34 0.45
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containi... 34 0.45
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protei... 34 0.58
sp|Q9FND8|PP409_ARATH Pentatricopeptide repeat-containing protei... 34 0.58
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protei... 34 0.58
sp|Q9SVH3|PP328_ARATH Pentatricopeptide repeat-containing protei... 33 0.76
sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protei... 33 0.76
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protei... 33 0.99
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protei... 33 0.99
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protei... 33 0.99
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protei... 33 0.99
sp|Q9FNN9|PP370_ARATH Putative pentatricopeptide repeat-containi... 32 1.7
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protei... 32 1.7
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protei... 32 1.7
sp|Q9ZUY1|PP173_ARATH Pentatricopeptide repeat-containing protei... 32 1.7
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protei... 32 2.2
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containi... 32 2.2
sp|Q9M065|PP352_ARATH Pentatricopeptide repeat-containing protei... 32 2.2
sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase... 32 2.9
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protei... 32 2.9

>sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein
At1g03560, mitochondrial OS=Arabidopsis thaliana
GN=At1g03560 PE=2 SV=1
Length = 660

Score = 41.2 bits (95), Expect = 0.004
Identities = 17/54 (31%), Positives = 32/54 (59%)
Frame = +2

Query: 407 SMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
S+ I LC++G++ EGY ++ + + PN + G A+SG ++DAI++
Sbjct: 331 SLVIGGLCKEGKLNEGYTVFENMIRKGSKPNVAIYTVLIDGYAKSGSVEDAIRL 384



Score = 30.4 bits (67), Expect = 6.4
Identities = 14/51 (27%), Positives = 27/51 (52%)
Frame = +2

Query: 407 SMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
S+ + LC+ GRVEE ++ + N+ + GL ++G++D+A
Sbjct: 401 SVVVNGLCKNGRVEEALDYFHTCRFDGLAINSMFYSSLIDGLGKAGRVDEA 451


>sp|Q9LSF5|PP254_ARATH Pentatricopeptide repeat-containing protein
At3g25210, mitochondrial OS=Arabidopsis thaliana
GN=At3g25210 PE=2 SV=1
Length = 379

Score = 40.8 bits (94), Expect = 0.005
Identities = 16/48 (33%), Positives = 29/48 (60%)
Frame = +2

Query: 425 LCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
+C +GRV +G YKE+Q + +PN + + L+ +LD+A++V
Sbjct: 268 VCEKGRVGQGLGFYKEMQVKGMVPNGSCYMVLICSLSMERRLDEAVEV 315


>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein
At5g64320, mitochondrial OS=Arabidopsis thaliana
GN=At5g64320 PE=2 SV=1
Length = 730

Score = 38.1 bits (87), Expect = 0.031
Identities = 17/49 (34%), Positives = 26/49 (53%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAI 562
I LCR G VEE KE+ R P+ ++GL R+G+++D +
Sbjct: 606 INGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNSLINGLCRAGRIEDGL 654



Score = 33.9 bits (76), Expect = 0.58
Identities = 16/48 (33%), Positives = 26/48 (54%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
I LCR GR+E+G ++++Q P+T +S L + G + DA
Sbjct: 641 INGLCRAGRIEDGLTMFRKLQAEGIPPDTVTFNTLMSWLCKGGFVYDA 688



Score = 30.4 bits (67), Expect = 6.4
Identities = 13/50 (26%), Positives = 29/50 (58%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQ 565
I LCR G V++ + ++++ P+ + ++GL RSG +++A++
Sbjct: 571 IKGLCRAGEVDKARSLFEKMLRDGHAPSNISCNILINGLCRSGMVEEAVE 620


>sp|Q9M3A8|PP273_ARATH Pentatricopeptide repeat-containing protein
At3g49240 OS=Arabidopsis thaliana GN=EMB1796 PE=2 SV=1
Length = 629

Score = 37.7 bits (86), Expect = 0.040
Identities = 20/65 (30%), Positives = 37/65 (56%)
Frame = +2

Query: 365 KDENLRPAGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSG 544
+++N++P Y +G + + ++G+++EG A+YK + N PN L ++G
Sbjct: 412 EEKNVKP-DEYTYGLL-MDTCFKEGKIDEGAAYYKTMVESNLRPNLAVYNRLQDQLIKAG 469

Query: 545 KLDDA 559
KLDDA
Sbjct: 470 KLDDA 474


>sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein
At4g19440, chloroplastic OS=Arabidopsis thaliana
GN=At4g19440 PE=2 SV=2
Length = 838

Score = 37.0 bits (84), Expect = 0.069
Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
Frame = +2

Query: 329 NRNKNSSSFDFGKD--ENLRPAGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNT 502
N NK + F D N Y + M I C+ R EEG + E+ ++N PNT
Sbjct: 600 NMNKVEEAIQFWDDCKRNGMLPDVYTYSVM-IDGCCKAERTEEGQEFFDEMMSKNVQPNT 658

Query: 503 EALLETVSGLARSGKLDDAIQV 568
+ RSG+L A+++
Sbjct: 659 VVYNHLIRAYCRSGRLSMALEL 680



Score = 31.6 bits (70), Expect = 2.9
Identities = 14/48 (29%), Positives = 23/48 (47%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
I A C+ G+VEE + +++ PN + GL G+ D+A
Sbjct: 280 INAFCKGGKVEEAVKLFSKMEEAGVAPNVVTFNTVIDGLGMCGRYDEA 327


>sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein
At4g26680, mitochondrial OS=Arabidopsis thaliana
GN=At4g26680 PE=2 SV=1
Length = 521

Score = 36.2 bits (82), Expect = 0.12
Identities = 19/52 (36%), Positives = 29/52 (55%)
Frame = +2

Query: 413 HIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
++ +L QGRV+ Y+E++ PN L +SG RSGKLD I++
Sbjct: 209 YMSSLLGQGRVDIALRFYREMRRCKISPNPYTLNMVMSGYCRSGKLDKGIEL 260


>sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein
At5g61990, mitochondrial OS=Arabidopsis thaliana
GN=At5g61990 PE=2 SV=1
Length = 974

Score = 35.4 bits (80), Expect = 0.20
Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 1/92 (1%)
Frame = +2

Query: 296 GSTFSGKQDSSNRNKNSSSFDFGKDENLRP-AGSYNHGSMHIIALCRQGRVEEGYAHYKE 472
G +G N K SS FD +E L P YN M + CR G +E+ E
Sbjct: 631 GVLINGFSKLGNMQKASSIFDEMVEEGLTPNVIIYN---MLLGGFCRSGEIEKAKELLDE 687

Query: 473 IQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
+ + PN + G +SG L +A ++
Sbjct: 688 MSVKGLHPNAVTYCTIIDGYCKSGDLAEAFRL 719


>sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein
At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3
PE=1 SV=1
Length = 1112

Score = 35.4 bits (80), Expect = 0.20
Identities = 16/52 (30%), Positives = 31/52 (59%)
Frame = +2

Query: 407 SMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAI 562
S+ + LC GRV+EG ++KE++ P+ ++GL +S +L++A+
Sbjct: 965 SVLVDCLCMVGRVDEGLHYFKELKESGLNPDVVCYNLIINGLGKSHRLEEAL 1016



Score = 33.9 bits (76), Expect = 0.58
Identities = 15/46 (32%), Positives = 27/46 (58%)
Frame = +2

Query: 431 RQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
+ G+++E + YKE+ T NT +SGL ++G +DDA+ +
Sbjct: 832 KSGKIDELFELYKEMSTHECEANTITHNIVISGLVKAGNVDDALDL 877



Score = 30.4 bits (67), Expect = 6.4
Identities = 14/49 (28%), Positives = 25/49 (51%)
Frame = +2

Query: 422 ALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
ALC+ G E + ++ + +PN + GL R +LDDA+++
Sbjct: 372 ALCKAGNFGEAFDTLDVMRDQGILPNLHTYNTLICGLLRVHRLDDALEL 420


>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein
At3g22470, mitochondrial OS=Arabidopsis thaliana
GN=At3g22470 PE=2 SV=1
Length = 619

Score = 35.4 bits (80), Expect = 0.20
Identities = 18/51 (35%), Positives = 30/51 (58%)
Frame = +2

Query: 407 SMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
S+ I + C+ RV++G ++EI ++ +PNT V G +SGKL+ A
Sbjct: 389 SILINSYCKAKRVDDGMRLFREISSKGLIPNTITYNTLVLGFCQSGKLNAA 439


>sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein
At1g62680, mitochondrial OS=Arabidopsis thaliana
GN=At1g62680 PE=2 SV=2
Length = 548

Score = 34.7 bits (78), Expect = 0.34
Identities = 16/51 (31%), Positives = 27/51 (52%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
I +LC+ RV + + +KEI+ + PN V+GL S + DA ++
Sbjct: 197 IDSLCKTKRVNDAFDFFKEIERKGIRPNVVTYTALVNGLCNSSRWSDAARL 247


tr_hit_id A9XLE8
Definition tr|A9XLE8|A9XLE8_PETIN Putative uncharacterized protein OS=Petunia integrifolia subsp. inflata
Align length 48
Score (bit) 40.8
E-value 0.053
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920384|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E02.
(568 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9XLE8|A9XLE8_PETIN Putative uncharacterized protein OS=Petun... 41 0.053
tr|A9XLG4|A9XLG4_SOLBU Putative uncharacterized protein OS=Solan... 40 0.069
tr|A5C4F1|A5C4F1_VITVI Putative uncharacterized protein OS=Vitis... 40 0.069
tr|A7QLJ5|A7QLJ5_VITVI Chromosome undetermined scaffold_119, who... 40 0.090
tr|A2X6I2|A2X6I2_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.090
tr|Q6EPV3|Q6EPV3_ORYSJ Os02g0582300 protein OS=Oryza sativa subs... 39 0.15
tr|Q5Z6A6|Q5Z6A6_ORYSJ Putative fertility restorer homologue OS=... 39 0.15
tr|Q0DBH2|Q0DBH2_ORYSJ Os06g0565000 protein OS=Oryza sativa subs... 39 0.15
tr|A3A8E4|A3A8E4_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.15
tr|A7R943|A7R943_VITVI Chromosome undetermined scaffold_3296, wh... 38 0.45
tr|A7R427|A7R427_VITVI Chromosome undetermined scaffold_610, who... 38 0.45
tr|A5AXD2|A5AXD2_VITVI Putative uncharacterized protein OS=Vitis... 38 0.45
tr|Q6YW98|Q6YW98_ORYSJ Os09g0110200 protein OS=Oryza sativa subs... 37 0.59
tr|Q6ETX2|Q6ETX2_ORYSJ Os02g0266200 protein OS=Oryza sativa subs... 37 0.59
tr|A3BW04|A3BW04_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.59
tr|A2YYF0|A2YYF0_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.59
tr|Q8L8A4|Q8L8A4_PETHY Fertility restorer OS=Petunia hybrida GN=... 37 0.77
tr|A7QKQ4|A7QKQ4_VITVI Chromosome chr2 scaffold_113, whole genom... 37 0.77
tr|A2X384|A2X384_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.77
tr|Q8L8A3|Q8L8A3_PETHY Fertility restorer-like protein OS=Petuni... 37 1.00
tr|Q8L8A2|Q8L8A2_PETHY Fertility restorer-like protein OS=Petuni... 37 1.00
tr|Q2QXL4|Q2QXL4_ORYSJ Os12g0152600 protein OS=Oryza sativa subs... 37 1.00
tr|A2ZI56|A2ZI56_ORYSI Putative uncharacterized protein OS=Oryza... 37 1.00
tr|B8LCW5|B8LCW5_THAPS Predicted protein OS=Thalassiosira pseudo... 36 1.7
tr|A7PK49|A7PK49_VITVI Chromosome chr15 scaffold_19, whole genom... 36 1.7
tr|A7NX22|A7NX22_VITVI Chromosome chr5 scaffold_2, whole genome ... 36 1.7
tr|A5AM12|A5AM12_VITVI Putative uncharacterized protein OS=Vitis... 36 1.7
tr|Q9Z0Q0|Q9Z0Q0_MOUSE Erythroid cell-specific and testis-specif... 35 2.2
tr|Q9WUT1|Q9WUT1_MOUSE Erythroid cell-specific and testis-specif... 35 2.2
tr|Q8H473|Q8H473_ORYSJ Os07g0671200 protein OS=Oryza sativa subs... 35 2.2

>tr|A9XLE8|A9XLE8_PETIN Putative uncharacterized protein OS=Petunia
integrifolia subsp. inflata GN=8.PETUNIA.2 PE=4 SV=1
Length = 406

Score = 40.8 bits (94), Expect = 0.053
Identities = 21/48 (43%), Positives = 28/48 (58%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
I+ LC++GR E GY +KE N+MP+ L V GL + KL DA
Sbjct: 317 ILYLCKKGRFETGYKVFKESVRVNKMPDFNTLKCLVEGLVKREKLKDA 364


>tr|A9XLG4|A9XLG4_SOLBU Putative uncharacterized protein OS=Solanum
bulbocastanum GN=8.POTATO.8 PE=4 SV=1
Length = 405

Score = 40.4 bits (93), Expect = 0.069
Identities = 20/48 (41%), Positives = 28/48 (58%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
I LC++GR E GY +KE ++P+ + L V GLA+ KL DA
Sbjct: 319 IFYLCKKGRFETGYKVFKESVKVQKIPDFDTLKYLVEGLAKKSKLKDA 366


>tr|A5C4F1|A5C4F1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_008668 PE=4 SV=1
Length = 477

Score = 40.4 bits (93), Expect = 0.069
Identities = 21/62 (33%), Positives = 34/62 (54%)
Frame = +2

Query: 383 PAGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAI 562
P SY +G++ I LCR G++ E +KE++T+ P + GL +S LD AI
Sbjct: 188 PPHSYTYGTL-IXGLCRLGKIGEAKELFKEMETKACSPTVVTYXSLIHGLCQSKDLDSAI 246

Query: 563 QV 568
++
Sbjct: 247 RL 248


>tr|A7QLJ5|A7QLJ5_VITVI Chromosome undetermined scaffold_119, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00001644001 PE=4 SV=1
Length = 503

Score = 40.0 bits (92), Expect = 0.090
Identities = 21/62 (33%), Positives = 34/62 (54%)
Frame = +2

Query: 383 PAGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAI 562
P SY +G++ I LCR G++ E +KE++T+ P + GL +S LD AI
Sbjct: 188 PPDSYTYGTL-INGLCRLGKIGEAKELFKEMETKACSPTVVTYTSLIHGLCQSKDLDSAI 246

Query: 563 QV 568
++
Sbjct: 247 RL 248


>tr|A2X6I2|A2X6I2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07823 PE=4 SV=1
Length = 703

Score = 40.0 bits (92), Expect = 0.090
Identities = 19/58 (32%), Positives = 33/58 (56%)
Frame = +2

Query: 386 AGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
A Y + ++ I ALC+ GR ++ + + ++TR PN ++GL +SGK+D A
Sbjct: 285 ADQYTYNAL-INALCKDGRTDQACSLFDSLETRGIKPNAVTFNSLINGLCKSGKVDIA 341


>tr|Q6EPV3|Q6EPV3_ORYSJ Os02g0582300 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0016D04.14 PE=4 SV=1
Length = 845

Score = 39.3 bits (90), Expect = 0.15
Identities = 19/58 (32%), Positives = 32/58 (55%)
Frame = +2

Query: 386 AGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
A Y + ++ I ALC+ GR ++ + + ++TR PN ++GL +SGK D A
Sbjct: 427 ADQYTYNAL-INALCKDGRTDQACSLFDSLETRGIKPNAVTFNSLINGLCKSGKADIA 483


>tr|Q5Z6A6|Q5Z6A6_ORYSJ Putative fertility restorer homologue
OS=Oryza sativa subsp. japonica GN=P0513E02.9 PE=4 SV=1
Length = 713

Score = 39.3 bits (90), Expect = 0.15
Identities = 16/51 (31%), Positives = 31/51 (60%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
I LC+ G ++E +H+ +++ PN +A V GL ++G L++A+Q+
Sbjct: 510 IDGLCKAGSIDEAISHFNKMRDLGLDPNVQAYTALVDGLCKNGCLNEAVQL 560


>tr|Q0DBH2|Q0DBH2_ORYSJ Os06g0565000 protein OS=Oryza sativa subsp.
japonica GN=Os06g0565000 PE=4 SV=1
Length = 687

Score = 39.3 bits (90), Expect = 0.15
Identities = 16/51 (31%), Positives = 31/51 (60%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQV 568
I LC+ G ++E +H+ +++ PN +A V GL ++G L++A+Q+
Sbjct: 510 IDGLCKAGSIDEAISHFNKMRDLGLDPNVQAYTALVDGLCKNGCLNEAVQL 560


>tr|A3A8E4|A3A8E4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007066 PE=4 SV=1
Length = 667

Score = 39.3 bits (90), Expect = 0.15
Identities = 19/58 (32%), Positives = 32/58 (55%)
Frame = +2

Query: 386 AGSYNHGSMHIIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDA 559
A Y + ++ I ALC+ GR ++ + + ++TR PN ++GL +SGK D A
Sbjct: 249 ADQYTYNAL-INALCKDGRTDQACSLFDSLETRGIKPNAVTFNSLINGLCKSGKADIA 305


>tr|A7R943|A7R943_VITVI Chromosome undetermined scaffold_3296, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00012708001 PE=4 SV=1
Length = 419

Score = 37.7 bits (86), Expect = 0.45
Identities = 16/50 (32%), Positives = 31/50 (62%)
Frame = +2

Query: 416 IIALCRQGRVEEGYAHYKEIQTRNEMPNTEALLETVSGLARSGKLDDAIQ 565
I ALCR G +E+G A ++++ ++ PN + ++GL R+G + A++
Sbjct: 268 IKALCRAGNIEKGLALFEDMMSKGLNPNNISCNILINGLCRTGNIQHALE 317