BP920385
Clone id YMU001_000136_E03
Library
Length 489
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTTGCAATTTCCCGCCTTAAATTACAATGCAAGGAAAAGGGAGATGTGTGGCTTACATCA
ACCATATCCTTGCTACAATCTTGACCCAGATCCCTGCTACAATTCTGTCAAAAGTTCTAA
GTTCCCACCCACAGCTTACTTGCTTCTTGTGGTTAGTTTACTATGAAGAACTTCCTTTAC
ATACACGGGGGCCTCAACCCAGAGCTCCTACCTTGATGTCAAGATCTAACAGACTACTCT
CTACATTAACAAGTGTGAGATGTTAACCTTCGAAGATGAGACTACAGAACCCATGATGAC
AAATCATTCCTCATCTTCACAGTCGTAGTCCTCTTCTGGCTGAAATACATTTTGATCCTG
ATGAACTTTTAATGAAACCGTGTCAGGACTAAGTCCTTGTAATCCTGGCCCTGACCATTG
AGAATGATCTTCCTCCTTCCCAACTGCCACCTCACCATTTTCATCCAATTCCATGTTCAG
ATCGAAGTC
■■Homology search results ■■ -
sp_hit_id P40850
Definition sp|P40850|MKT1_YEAST Protein MKT1 OS=Saccharomyces cerevisiae
Align length 31
Score (bit) 30.0
E-value 5.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920385|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E03.
(489 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P40850|MKT1_YEAST Protein MKT1 OS=Saccharomyces cerevisiae GN... 30 5.8
sp|O15353|FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens GN... 29 9.9

>sp|P40850|MKT1_YEAST Protein MKT1 OS=Saccharomyces cerevisiae
GN=MKT1 PE=1 SV=2
Length = 830

Score = 30.0 bits (66), Expect = 5.8
Identities = 11/31 (35%), Positives = 18/31 (58%)
Frame = +3

Query: 381 CQD*VLVILALTIENDLPPSQLPPHHFHPIP 473
C + +A+ + NDL P+ LPP +P+P
Sbjct: 248 CTHEEFIDIAMAVGNDLQPTTLPPLQIYPVP 278


>sp|O15353|FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens
GN=FOXN1 PE=2 SV=1
Length = 648

Score = 29.3 bits (64), Expect = 9.9
Identities = 11/30 (36%), Positives = 18/30 (60%)
Frame = +3

Query: 387 D*VLVILALTIENDLPPSQLPPHHFHPIPC 476
D ++++ + + +PP Q PPH F P PC
Sbjct: 557 DPLVLVTSSPTSSSMPPPQPPPHCFPPGPC 586


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920385|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E03.
(489 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******