BP920386
Clone id YMU001_000136_E04
Library
Length 495
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTGTACCTGCCTTTACTTCAGAGCAGAACAGATTGCGAGAAGAGCAGGTTGAATATAGC
AGAAGAAACTGATGTCGGGTGCAGAGAAAGAGTGAGAAAGTGGGAGAGATGACGCATACT
GAACTTGCAAAGCTGCCCGCTCGGAGGGCCACCATTGGTCACTGCCACACTTTGGCTCAG
GATTCTAGAAAGAAAAACCAGTCAACTCGCATGTCTTTACCTTCAATCAGCCCTGCTCAA
ACCAATAAGTAACCCGTTATGGGGCTCCTTATTCATAAAACCAGGCAGCCCCAGTCACCA
TACATCTCTCTCAAACAACTAGTTGCCCCGTTCCATGTTGCTCCTCGTGAGCATAAGGTG
CCAATAGCACAAAATGAGCATGAAAAAAAATCTGGGTTCTATCTCCCAGTAGGAGCTCCA
AATACTAACATCTTCAAACACCCACTCGGTCCACTCTTTGTTTAATCCCTACATCTCGCC
CGGCTCTCTAGCCCG
■■Homology search results ■■ -
sp_hit_id Q05952
Definition sp|Q05952|STP2_HUMAN Nuclear transition protein 2 OS=Homo sapiens
Align length 69
Score (bit) 30.8
E-value 3.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920386|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E04.
(495 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q05952|STP2_HUMAN Nuclear transition protein 2 OS=Homo sapien... 31 3.6
sp|Q9N1A5|STP2_GORGO Nuclear transition protein 2 (Fragment) OS=... 30 4.7
sp|P32687|YJBF_ECOLI Uncharacterized lipoprotein yjbF OS=Escheri... 30 6.0
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapie... 30 6.1

>sp|Q05952|STP2_HUMAN Nuclear transition protein 2 OS=Homo sapiens
GN=TNP2 PE=2 SV=1
Length = 138

Score = 30.8 bits (68), Expect = 3.6
Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
Frame = +1

Query: 109 MTHTELAK--LPARRATIGHCHTLAQDSRKKNQSTRMSLPSISPAQTNK*PVMGLLIHKT 282
+THT+L P R HC T +Q R+ ++ +R S SPA +++ P G
Sbjct: 10 ITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSQSSSQSPA-SHRNPT-GAHSSSG 67

Query: 283 RQPQSPYIS 309
Q QSP S
Sbjct: 68 HQSQSPNTS 76


>sp|Q9N1A5|STP2_GORGO Nuclear transition protein 2 (Fragment)
OS=Gorilla gorilla gorilla GN=TNP2 PE=2 SV=1
Length = 133

Score = 30.4 bits (67), Expect = 4.7
Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
Frame = +1

Query: 109 MTHTELAK--LPARRATIGHCHTLAQDSRKKNQSTRMSLPSISPAQTNK*PVMGLLIHKT 282
+THT+L P R HC T +Q R+ ++ +R S SPA +++ P G
Sbjct: 10 ITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSRSSSQSPA-SHRNPT-GAHSSSG 67

Query: 283 RQPQSPYIS 309
Q QSP S
Sbjct: 68 HQSQSPNTS 76


>sp|P32687|YJBF_ECOLI Uncharacterized lipoprotein yjbF
OS=Escherichia coli (strain K12) GN=yjbF PE=4 SV=2
Length = 212

Score = 30.0 bits (66), Expect = 6.0
Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
Frame = +2

Query: 185 LERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 36


>sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens
GN=TBC1D13 PE=1 SV=2
Length = 275

Score = 30.0 bits (66), Expect = 6.1
Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
Frame = -1

Query: 447 EWVFEDV-SIWSSYWEIEPRFFFMLILCYWHLMLTRSNMERGN 322
E++ DV IW S + + RF F+L++C LML R + G+
Sbjct: 203 EFLLPDVIRIWDSLFADDNRFDFLLLVCCAMLMLIREQLLEGD 245


tr_hit_id Q8X5Y0
Definition tr|Q8X5Y0|Q8X5Y0_ECO57 Putative uncharacterized protein yjbF (Putative uncharacterized protein ECs5010) OS=Escherichia coli O157:H7
Align length 46
Score (bit) 38.9
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920386|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E04.
(495 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8X5Y0|Q8X5Y0_ECO57 Putative uncharacterized protein yjbF (Pu... 39 0.13
tr|Q8CVI8|Q8CVI8_ECOL6 Hypothetical lipoprotein yjbF OS=Escheric... 39 0.13
tr|Q83IP1|Q83IP1_SHIFL Putative uncharacterized protein yjbF OS=... 39 0.13
tr|Q3YUV8|Q3YUV8_SHISS Putative uncharacterized protein yjbF OS=... 39 0.13
tr|Q328Y2|Q328Y2_SHIDS Putative uncharacterized protein yjbF OS=... 39 0.13
tr|Q31TW9|Q31TW9_SHIBS Putative uncharacterized protein yjbF OS=... 39 0.13
tr|Q1R3R1|Q1R3R1_ECOUT Putative uncharacterized protein OS=Esche... 39 0.13
tr|B6I5N9|B6I5N9_ECOSE Putative uncharacterized protein OS=Esche... 39 0.13
tr|A8A7C6|A8A7C6_ECOHS Putative uncharacterized protein OS=Esche... 39 0.13
tr|A7ZUP5|A7ZUP5_ECO24 Putative uncharacterized protein OS=Esche... 39 0.13
tr|A1AIK5|A1AIK5_ECOK1 Putative uncharacterized protein yjbF OS=... 39 0.13
tr|B2N305|B2N305_ECOLX Putative uncharacterized protein OS=Esche... 39 0.13
tr|Q2U481|Q2U481_ASPOR Predicted protein OS=Aspergillus oryzae G... 37 0.68
tr|Q38DK9|Q38DK9_9TRYP Structural maintenance of chromosome 1, p... 35 1.5
tr|A8XHG1|A8XHG1_CAEBR CBR-SUCH-1 protein OS=Caenorhabditis brig... 35 2.5
tr|B8NTN5|B8NTN5_ASPFL Putative uncharacterized protein OS=Asper... 34 3.4
tr|Q8ZKI3|Q8ZKI3_SALTY Putative outer membrane lipoprotein OS=Sa... 34 4.3
tr|Q57H04|Q57H04_SALCH Putative outer membrane lipoprotein OS=Sa... 34 4.3
tr|B5R7S2|B5R7S2_SALG2 Putative lipoprotein OS=Salmonella gallin... 34 4.3
tr|B5QYI6|B5QYI6_SALEP Putative lipoprotein OS=Salmonella enteri... 34 4.3
tr|A9MHA5|A9MHA5_SALAR Putative uncharacterized protein OS=Salmo... 33 7.3
tr|A4HHA1|A4HHA1_LEIBR Putative uncharacterized protein OS=Leish... 33 7.3
tr|Q4STT2|Q4STT2_TETNG Chromosome 4 SCAF14117, whole genome shot... 33 9.8
tr|A5GQA0|A5GQA0_SYNR3 Glycosyltransferase of family GT4 OS=Syne... 33 9.8
tr|A3Y727|A3Y727_9GAMM Leucyl-tRNA synthetase OS=Marinomonas sp.... 33 9.8
tr|Q9VZQ3|Q9VZQ3_DROME Karst, isoform A OS=Drosophila melanogast... 33 9.8
tr|Q7KV70|Q7KV70_DROME Karst, isoform C OS=Drosophila melanogast... 33 9.8
tr|Q7KV69|Q7KV69_DROME Karst, isoform B OS=Drosophila melanogast... 33 9.8
tr|Q23980|Q23980_DROME Beta-heavy-spectrin (Fragment) OS=Drosoph... 33 9.8
tr|A8JNJ6|A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogast... 33 9.8

>tr|Q8X5Y0|Q8X5Y0_ECO57 Putative uncharacterized protein yjbF
(Putative uncharacterized protein ECs5010)
OS=Escherichia coli O157:H7 GN=yjbF PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPAFILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q8CVI8|Q8CVI8_ECOL6 Hypothetical lipoprotein yjbF OS=Escherichia
coli O6 GN=yjbF PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q83IP1|Q83IP1_SHIFL Putative uncharacterized protein yjbF
OS=Shigella flexneri GN=yjbF PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q3YUV8|Q3YUV8_SHISS Putative uncharacterized protein yjbF
OS=Shigella sonnei (strain Ss046) GN=yjbF PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q328Y2|Q328Y2_SHIDS Putative uncharacterized protein yjbF
OS=Shigella dysenteriae serotype 1 (strain Sd197)
GN=yjbF PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q31TW9|Q31TW9_SHIBS Putative uncharacterized protein yjbF
OS=Shigella boydii serotype 4 (strain Sb227) GN=yjbF
PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|Q1R3R1|Q1R3R1_ECOUT Putative uncharacterized protein
OS=Escherichia coli (strain UTI89 / UPEC) GN=UTI89_C4595
PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|B6I5N9|B6I5N9_ECOSE Putative uncharacterized protein
OS=Escherichia coli (strain SE11) GN=ECSE_4316 PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|A8A7C6|A8A7C6_ECOHS Putative uncharacterized protein
OS=Escherichia coli O9:H4 (strain HS) GN=EcHS_A4266 PE=4
SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46


>tr|A7ZUP5|A7ZUP5_ECO24 Putative uncharacterized protein
OS=Escherichia coli O139:H28 (strain E24377A / ETEC)
GN=EcE24377A_4575 PE=4 SV=1
Length = 222

Score = 38.9 bits (89), Expect = 0.13
Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 2/46 (4%)
Frame = +2

Query: 155 LVTATLWLRILERKTSQLACLYLQ--SALLKPISNPLWGSLFIKPG 286
+V LW R+++R L CL LQ SA K + N LW SLF PG
Sbjct: 1 MVILPLWRRVVKRPALILICLLLQACSATTKELGNSLWDSLFGTPG 46