BP920393
Clone id YMU001_000136_E11
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAACTTTCCTCTTGACAGAGCAGCTCTGAAACCCTCTTATTCTAGAATCTGCAAGTGGA
CATTTGGAGGGCTTTGAGGCCTGTGGTGGAAAAGGAAAATCTTCACATAAAAACTAAATG
GAAGCATTCTCAGAAACTACTTTGTGATGATTGCATTCGACTCACAGAGTTGAACATTCC
TATAGATAGAGCAGGTTGTAAACAATCTTTTTGTAGAATCTGCGATTGGAGATTTGGACT
GCTTTGAGGCCTACTGTAGTAAAGGAAATAACTTCATCTAAAAACCAAACGGAAGCATTC
ACAGACAATTCTTAGTGATCATTGGATTGAACTAACAGAGCTGAACATTCCTTTAGATGG
AGCAGTTTCCAAACCCACTTTCTGTAGAATCTGCAAGTGGATATTTGGACTTCTCTGAGA
ATTTCGTTGGAAACGAGATAAACTTCCCAGAACTACAGGGAAGCATTGTGAGAAAATTCT
TTGTGATGTTTGCATTCAACTCACAGAGTTGAACCTTGCTTTCATAGTTCAGCTTTCAAA
CACTCT
■■Homology search results ■■ -
sp_hit_id Q9D5U8
Definition sp|Q9D5U8|CT152_MOUSE Uncharacterized protein C20orf152 homolog OS=Mus musculus
Align length 55
Score (bit) 34.7
E-value 0.31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920393|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E11.
(546 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9D5U8|CT152_MOUSE Uncharacterized protein C20orf152 homolog ... 35 0.31
sp|P00137|CYC3_DESAC Cytochrome c3 OS=Desulfuromonas acetoxidans... 30 9.9

>sp|Q9D5U8|CT152_MOUSE Uncharacterized protein C20orf152 homolog
OS=Mus musculus PE=1 SV=2
Length = 673

Score = 34.7 bits (78), Expect = 0.31
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = -2

Query: 482 KEFSHNASL*FWEVYLVSNEILREVQISTCRFYRKWVWKLLHLKECSALLVQSND 318
K+F ++A + F + + EILR V + C Y KWVW+ L L + L + N+
Sbjct: 362 KDFMNSAFITF--ICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDNE 414


>sp|P00137|CYC3_DESAC Cytochrome c3 OS=Desulfuromonas acetoxidans
GN=cyd PE=1 SV=1
Length = 68

Score = 29.6 bits (65), Expect = 9.9
Identities = 12/33 (36%), Positives = 17/33 (51%)
Frame = +2

Query: 125 HSQKLLCDDCIRLTELNIPIDRAGCKQSFCRIC 223
H++KL CD C T I ID+ + C+ C
Sbjct: 20 HAEKLGCDACHEGTPAKIAIDKKSAHKDACKTC 52


tr_hit_id Q847P1
Definition tr|Q847P1|Q847P1_ASTYP Nef attachable protein OS=Aster yellows phytoplasma
Align length 57
Score (bit) 63.5
E-value 7.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920393|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_E11.
(546 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q847P1|Q847P1_ASTYP Nef attachable protein OS=Aster yellows p... 64 7e-09
tr|Q847P2|Q847P2_ASTYP Putative uncharacterized protein (Fragmen... 55 2e-06
tr|B4NRN9|B4NRN9_DROWI GK23686 OS=Drosophila willistoni GN=GK236... 43 0.012
tr|Q6QI81|Q6QI81_RAT Ribosomal protein L19 OS=Rattus norvegicus ... 39 0.14
tr|B2RU56|B2RU56_MOUSE 4921517L17Rik protein OS=Mus musculus GN=... 35 3.4
tr|A2AV96|A2AV96_MOUSE Novel transcript OS=Mus musculus GN=49215... 35 3.4
tr|Q8DFR9|Q8DFR9_VIBVU Predicted hydrolase/acyltransferase OS=Vi... 35 3.4
tr|Q7MML5|Q7MML5_VIBVY Putative uncharacterized protein VV1052 O... 35 3.4
tr|Q3TRZ7|Q3TRZ7_MOUSE Putative uncharacterized protein (Fragmen... 34 5.8
tr|A2AV95|A2AV95_MOUSE Novel transcript OS=Mus musculus GN=49215... 34 5.8

>tr|Q847P1|Q847P1_ASTYP Nef attachable protein OS=Aster yellows
phytoplasma PE=4 SV=1
Length = 65

Score = 63.5 bits (153), Expect = 7e-09
Identities = 30/57 (52%), Positives = 38/57 (66%)
Frame = +2

Query: 83 VVEKENLHIKTKWKHSQKLLCDDCIRLTELNIPIDRAGCKQSFCRICDWRFGLL*GL 253
+VE++ L IKT+ HSQKLLCD C++LTE N+ RA K S C +C W F L GL
Sbjct: 1 MVERKYLRIKTRQYHSQKLLCDVCVQLTEFNLSFHRAVWKPSVCEVCKWIFKRLWGL 57



Score = 53.5 bits (127), Expect = 7e-06
Identities = 24/47 (51%), Positives = 30/47 (63%)
Frame = +2

Query: 299 SQTILSDHWIELTELNIPLDGAVSKPTFCRICKWIFGLL*EFRWKRD 439
SQ +L D ++LTE N+ AV KP+ C +CKWIF L RWKRD
Sbjct: 16 SQKLLCDVCVQLTEFNLSFHRAVWKPSVCEVCKWIFKRLWGLRWKRD 62



Score = 38.9 bits (89), Expect = 0.18
Identities = 15/25 (60%), Positives = 20/25 (80%)
Frame = +2

Query: 449 RTTGKHCEKILCDVCIQLTELNLAF 523
+T H +K+LCDVC+QLTE NL+F
Sbjct: 10 KTRQYHSQKLLCDVCVQLTEFNLSF 34



Score = 38.1 bits (87), Expect = 0.31
Identities = 17/34 (50%), Positives = 18/34 (52%)
Frame = +3

Query: 3 NFPLDRAALKPSYSRICKWTFGGL*GLWWKRKIF 104
N RA KPS +CKW F L GL WKR F
Sbjct: 31 NLSFHRAVWKPSVCEVCKWIFKRLWGLRWKRDFF 64


>tr|Q847P2|Q847P2_ASTYP Putative uncharacterized protein (Fragment)
OS=Aster yellows phytoplasma PE=4 SV=1
Length = 58

Score = 55.1 bits (131), Expect = 2e-06
Identities = 30/47 (63%), Positives = 35/47 (74%)
Frame = +3

Query: 126 ILRNYFVMIAFDSQS*TFL*IEQVVNNLFVESAIGDLDCFEAYCSKG 266
ILR+YFVM AF+SQS TFL IEQ N LFV+SA G L+ FEA+ G
Sbjct: 2 ILRSYFVMCAFNSQSLTFLFIEQFGNPLFVKSASGYLNVFEAFVGNG 48



Score = 50.8 bits (120), Expect = 5e-05
Identities = 28/48 (58%), Positives = 33/48 (68%)
Frame = +3

Query: 297 IHRQFLVIIGLN*QS*TFL*MEQFPNPLSVESASGYLDFSENFVGNEI 440
I R + V+ N QS TFL +EQF NPL V+SASGYL+ E FVGN I
Sbjct: 2 ILRSYFVMCAFNSQSLTFLFIEQFGNPLFVKSASGYLNVFEAFVGNGI 49



Score = 38.5 bits (88), Expect = 0.23
Identities = 20/36 (55%), Positives = 24/36 (66%)
Frame = +1

Query: 4 TFLLTEQL*NPLILESASGHLEGFEACGGKGKSSHK 111
TFL EQ NPL ++SASG+L FEA G G S+K
Sbjct: 18 TFLFIEQFGNPLFVKSASGYLNVFEAFVGNGIFSYK 53


>tr|B4NRN9|B4NRN9_DROWI GK23686 OS=Drosophila willistoni GN=GK23686
PE=4 SV=1
Length = 52

Score = 42.7 bits (99), Expect = 0.012
Identities = 23/38 (60%), Positives = 28/38 (73%)
Frame = +3

Query: 330 N*QS*TFL*MEQFPNPLSVESASGYLDFSENFVGNEIN 443
N QS TFL ME+F + + V+SASGYLD E FVGN I+
Sbjct: 5 NSQSITFLLMEEFGDTVFVKSASGYLDLFEAFVGNGIS 42



Score = 40.4 bits (93), Expect = 0.062
Identities = 21/40 (52%), Positives = 28/40 (70%)
Frame = +3

Query: 147 MIAFDSQS*TFL*IEQVVNNLFVESAIGDLDCFEAYCSKG 266
M AF+SQS TFL +E+ + +FV+SA G LD FEA+ G
Sbjct: 1 MCAFNSQSITFLLMEEFGDTVFVKSASGYLDLFEAFVGNG 40



Score = 33.5 bits (75), Expect = 7.5
Identities = 17/35 (48%), Positives = 25/35 (71%)
Frame = +1

Query: 4 TFLLTEQL*NPLILESASGHLEGFEACGGKGKSSH 108
TFLL E+ + + ++SASG+L+ FEA G G SS+
Sbjct: 10 TFLLMEEFGDTVFVKSASGYLDLFEAFVGNGISSY 44


>tr|Q6QI81|Q6QI81_RAT Ribosomal protein L19 OS=Rattus norvegicus
GN=RGD1311678 PE=2 SV=1
Length = 1042

Score = 39.3 bits (90), Expect = 0.14
Identities = 17/36 (47%), Positives = 23/36 (63%)
Frame = -2

Query: 425 EILREVQISTCRFYRKWVWKLLHLKECSALLVQSND 318
EILR V + TCR Y +WVW+ L L + L V +N+
Sbjct: 501 EILRMVDLGTCRTYYRWVWQQLELLDHKPLRVHNNE 536


>tr|B2RU56|B2RU56_MOUSE 4921517L17Rik protein OS=Mus musculus
GN=4921517L17Rik PE=2 SV=1
Length = 673

Score = 34.7 bits (78), Expect = 3.4
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = -2

Query: 482 KEFSHNASL*FWEVYLVSNEILREVQISTCRFYRKWVWKLLHLKECSALLVQSND 318
K+F ++A + F + + EILR V + C Y KWVW+ L L + L + N+
Sbjct: 362 KDFMNSAFITF--ICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDNE 414


>tr|A2AV96|A2AV96_MOUSE Novel transcript OS=Mus musculus
GN=4921517L17Rik PE=4 SV=1
Length = 544

Score = 34.7 bits (78), Expect = 3.4
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = -2

Query: 482 KEFSHNASL*FWEVYLVSNEILREVQISTCRFYRKWVWKLLHLKECSALLVQSND 318
K+F ++A + F + + EILR V + C Y KWVW+ L L + L + N+
Sbjct: 233 KDFMNSAFITF--ICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDNE 285


>tr|Q8DFR9|Q8DFR9_VIBVU Predicted hydrolase/acyltransferase
OS=Vibrio vulnificus GN=VV1_0137 PE=4 SV=1
Length = 284

Score = 34.7 bits (78), Expect = 3.4
Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
Frame = +2

Query: 71 ALRPVVEK--ENLHIKTKWKHSQKLLCDDCIRLTELNIP--IDRAGC 199
ALRP+VE+ E+ H +W+H KL CD RL++ + +D+ C
Sbjct: 182 ALRPIVERGVEHRHGIWQWRHDAKLKCDSLYRLSQKHAETILDQISC 228


>tr|Q7MML5|Q7MML5_VIBVY Putative uncharacterized protein VV1052
OS=Vibrio vulnificus (strain YJ016) GN=VV1052 PE=4 SV=1
Length = 284

Score = 34.7 bits (78), Expect = 3.4
Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
Frame = +2

Query: 71 ALRPVVEK--ENLHIKTKWKHSQKLLCDDCIRLTELNIP--IDRAGC 199
ALRP+VE+ E+ H +W+H KL CD RL++ + +D+ C
Sbjct: 182 ALRPIVERGVEHRHGIWQWRHDAKLKCDSLYRLSQKHAETILDQISC 228


>tr|Q3TRZ7|Q3TRZ7_MOUSE Putative uncharacterized protein (Fragment)
OS=Mus musculus GN=4921517L17Rik PE=2 SV=1
Length = 522

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/54 (35%), Positives = 29/54 (53%)
Frame = -2

Query: 482 KEFSHNASL*FWEVYLVSNEILREVQISTCRFYRKWVWKLLHLKECSALLVQSN 321
K+F ++A + F + + EILR V + C Y KWVW+ L L + L + N
Sbjct: 342 KDFMNSAFITF--ICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDN 393


>tr|A2AV95|A2AV95_MOUSE Novel transcript OS=Mus musculus
GN=4921517L17Rik PE=4 SV=1
Length = 425

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/54 (35%), Positives = 29/54 (53%)
Frame = -2

Query: 482 KEFSHNASL*FWEVYLVSNEILREVQISTCRFYRKWVWKLLHLKECSALLVQSN 321
K+F ++A + F + + EILR V + C Y KWVW+ L L + L + N
Sbjct: 245 KDFMNSAFITF--ICQGNCEILRLVALGDCSAYYKWVWQQLELLDHKPLRIHDN 296