BP920424
Clone id YMU001_000136_H08
Library
Length 555
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_H08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCATATCCTTTTCTACATTCCGTAGCTCAATCGTCTCAGTGAATGCGTAGCTTGGTACTT
ATCGAGGTACTGATGCAGTCCAGTCCGCCGGGAAATTCATACGATCTCTGTCGCAGAATT
CTCCAAAAGCAGATCTGCTCCGACAACCAGATCTTTAGGCTTCCTTTTATATTGCTAAGA
CAGTTTCTTTGGGTTCTAAATATGCAGAGGGATCTCTACCCAGCATTTTAAGGTTCGCTC
ATGAGTGCTGCAGAGAGTTTCATTTTACGGTATGTTGTGATATTTATGATGTCCTTTGAT
GCTCTAACATAGTGAAATGGCTATTATGTTTTGATTTTTGCTCTACTGACATGAGCAGAC
TGTCTTTTTGGTTTGGATTTTTTGCACTATGCACATGGGCAGACATGCTTTTCTTTCATA
TTGTCTGCTCATTTTATCATAGAATTAAAGGTTTTTGATAATTCTAGCCTGGTCAAGCGA
TTTGATCGTGTATGCTTGAGCATCGGAGGCGAAAATGTCAGGAACTTAGAAGGCTCGTGC
TACTTCAACGCGGTG
■■Homology search results ■■ -
sp_hit_id Q831X4
Definition sp|Q831X4|SYN_ENTFA Asparaginyl-tRNA synthetase OS=Enterococcus faecalis
Align length 104
Score (bit) 33.5
E-value 0.72
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920424|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_H08.
(555 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q831X4|SYN_ENTFA Asparaginyl-tRNA synthetase OS=Enterococcus ... 33 0.72
sp|O35298|AOAH_MOUSE Acyloxyacyl hydrolase OS=Mus musculus GN=Ao... 31 4.7
sp|Q66X22|NAL9B_MOUSE NACHT, LRR and PYD domains-containing prot... 30 6.0
sp|A5UM12|COFG_METS3 FO synthase subunit 1 OS=Methanobrevibacter... 30 6.0
sp|Q80TS5|ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus GN... 30 7.9
sp|Q2M1K9|ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens GN... 30 7.9

>sp|Q831X4|SYN_ENTFA Asparaginyl-tRNA synthetase OS=Enterococcus
faecalis GN=asnS PE=3 SV=1
Length = 450

Score = 33.5 bits (75), Expect = 0.72
Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 4/104 (3%)
Frame = -1

Query: 321 AISLC*SIKGHHKYHNIP*NETLCSTHERTLKCWVEIPLHI*NPKKLS*QYKRKP----K 154
AI L + ++ Y +I E S HE + + +P I N K + KP +
Sbjct: 298 AIELLQKEEANNDYDHIEWGEDFGSPHETFISNYYGVPTFILNYPKAIKAFYMKPHPTRE 357

Query: 153 DLVVGADLLLENSATEIV*ISRRTGLHQYLDKYQATHSLRRLSY 22
D+V+ ADL+ EI+ S R + YL + A L Y
Sbjct: 358 DVVICADLIAPEGYGEIIGGSERATDYDYLKEKVAEFGLSEEEY 401


>sp|O35298|AOAH_MOUSE Acyloxyacyl hydrolase OS=Mus musculus GN=Aoah
PE=2 SV=1
Length = 574

Score = 30.8 bits (68), Expect = 4.7
Identities = 16/53 (30%), Positives = 28/53 (52%)
Frame = +1

Query: 388 YAHGQTCFSFILSAHFIIELKVFDNSSLVKRFDRVCLSIGGENVRNLEGSCYF 546
Y+HGQ+C ++ I +L NSS+ +R+C + + L+ +CYF
Sbjct: 34 YSHGQSCLGCVVLVSVIEQLAEVHNSSVQVAMERLCSYLPEKLF--LKTACYF 84


>sp|Q66X22|NAL9B_MOUSE NACHT, LRR and PYD domains-containing protein
9B OS=Mus musculus GN=Nlrp9b PE=2 SV=1
Length = 1003

Score = 30.4 bits (67), Expect = 6.0
Identities = 14/27 (51%), Positives = 18/27 (66%)
Frame = -3

Query: 256 SLQHS*ANLKMLGRDPSAYLEPKETVL 176
+L H NLKMLG D SA+ E +T+L
Sbjct: 942 ALNHKRCNLKMLGLDKSAFSEESQTLL 968


>sp|A5UM12|COFG_METS3 FO synthase subunit 1 OS=Methanobrevibacter
smithii (strain PS / ATCC 35061 / DSM 861) GN=cofG PE=3
SV=2
Length = 339

Score = 30.4 bits (67), Expect = 6.0
Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
Frame = -3

Query: 235 NLKMLGRDPSAY-LEPKETVLAI*KEA*RSGC-RSRSAFGEFCDRD 104
N K DPSA L+ KE VLA KEA R GC + FGE D +
Sbjct: 35 NFKKTPDDPSAIILKTKEEVLASLKEAERYGCSEALFTFGEDADEE 80


>sp|Q80TS5|ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus
GN=Znf423 PE=1 SV=2
Length = 1292

Score = 30.0 bits (66), Expect = 7.9
Identities = 23/78 (29%), Positives = 36/78 (46%)
Frame = -3

Query: 415 KKSMSAHVHSAKNPNQKDSLLMSVEQKSKHNSHFTMLEHQRTS*ISQHTVK*NSLQHS*A 236
+ ++ AH+H A + NQK M EQ S + L+ R S H+V + + S A
Sbjct: 315 ESTLLAHIHQA-HANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVA 373

Query: 235 NLKMLGRDPSAYLEPKET 182
++ D SA +E T
Sbjct: 374 SMSSATPDSSASVERGST 391


>sp|Q2M1K9|ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens
GN=ZNF423 PE=1 SV=1
Length = 1284

Score = 30.0 bits (66), Expect = 7.9
Identities = 23/78 (29%), Positives = 36/78 (46%)
Frame = -3

Query: 415 KKSMSAHVHSAKNPNQKDSLLMSVEQKSKHNSHFTMLEHQRTS*ISQHTVK*NSLQHS*A 236
+ ++ AH+H A + NQK M EQ S + L+ R S H+V + + S A
Sbjct: 307 ENTLLAHIHQA-HANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVA 365

Query: 235 NLKMLGRDPSAYLEPKET 182
++ D SA +E T
Sbjct: 366 SMSSATPDSSASVERGST 383


tr_hit_id A7FRS1
Definition tr|A7FRS1|A7FRS1_CLOB1 Putative uncharacterized protein OS=Clostridium botulinum (strain ATCC 19397 / Type A)
Align length 56
Score (bit) 33.5
E-value 7.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920424|Adiantum capillus-veneris mRNA, clone:
YMU001_000136_H08.
(555 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7FRS1|A7FRS1_CLOB1 Putative uncharacterized protein OS=Clost... 33 7.9
tr|A5HZK7|A5HZK7_CLOBH Putative uncharacterized protein OS=Clost... 33 7.9

>tr|A7FRS1|A7FRS1_CLOB1 Putative uncharacterized protein
OS=Clostridium botulinum (strain ATCC 19397 / Type A)
GN=CLB_0703 PE=4 SV=1
Length = 447

Score = 33.5 bits (75), Expect = 7.9
Identities = 16/56 (28%), Positives = 28/56 (50%)
Frame = +1

Query: 355 ADCLFGLDFLHYAHGQTCFSFILSAHFIIELKVFDNSSLVKRFDRVCLSIGGENVR 522
ADCLFG +++ + + +L + +I +L D L F++ LS+ E R
Sbjct: 381 ADCLFGYEYITFFKSLSKMEIVLLSKYISDLSFEDEKDLYVEFNKYILSLRKEEQR 436


>tr|A5HZK7|A5HZK7_CLOBH Putative uncharacterized protein
OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC
13319 / Type A) GN=CBO0664 PE=4 SV=1
Length = 447

Score = 33.5 bits (75), Expect = 7.9
Identities = 16/56 (28%), Positives = 28/56 (50%)
Frame = +1

Query: 355 ADCLFGLDFLHYAHGQTCFSFILSAHFIIELKVFDNSSLVKRFDRVCLSIGGENVR 522
ADCLFG +++ + + +L + +I +L D L F++ LS+ E R
Sbjct: 381 ADCLFGYEYITFFKSLSKMEIVLLSKYISDLSFEDEKDLYVEFNKYILSLRKEEQR 436