BP920440
Clone id YMU001_000137_B03
Library
Length 564
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000137_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAAACCCTTGTTCACAATCTCTGCATGTATCTGTCGTATGTTAACTATGGGGCTTGACAC
AGTAATACATGCCCTCAAGCTGCTATCAAGGGTGATGGAATTTGCGGAAACCTTTTCAAG
GTGCATTTCTCCTAAGCACATCAATGCTTCTTTGCCAAACCCATGTTCTGAATAGCCTCC
AATTAACGTAGTCCAAGCCACTACATCTCGATTGGCCATTTCATCCAGCACTTTCCGTGC
ATCTAAAAATAGCCCACATTTGGCATAGAGGCTAAGTAAGGCATTACCAACAGCATAATC
TCCGTCAATTCCCTCTTTAACAGCCCGAATATGTATGGTACGACCTCTCTCAATGGCTCC
TATTCTGCTACAGCATTTCAAGGTGCAACATAAAGTGATTGAACTTGGTAATACCCCCTC
AAGCGCCATTTGCTCTATGCAATGAGCTGCCTTTTCATCAAATTCAGAATCTGTGCAGGC
TGTGATTAGAATGTTCCACGTTACGACATTCCGAACTGGCAGCGTATCAAAGACCCACCA
TGCCTCAACAAATGAGGCACACCT
■■Homology search results ■■ -
sp_hit_id Q0WNP3
Definition sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein At4g18520 OS=Arabidopsis thaliana
Align length 184
Score (bit) 127.0
E-value 5.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920440|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_B03.
(564 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 127 5e-29
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 116 7e-26
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 116 9e-26
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 115 1e-25
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 111 3e-24
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 110 6e-24
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 109 8e-24
sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containi... 109 8e-24
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 109 1e-23
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 108 2e-23
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 108 2e-23
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 108 2e-23
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 107 3e-23
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 107 3e-23
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 107 4e-23
sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protei... 107 5e-23
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 107 5e-23
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 106 7e-23
sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protei... 106 7e-23
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 106 9e-23
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 106 9e-23
sp|Q38959|PP257_ARATH Pentatricopeptide repeat-containing protei... 106 9e-23
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 104 3e-22
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 104 3e-22
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 104 3e-22
sp|Q56X05|PPR15_ARATH Pentatricopeptide repeat-containing protei... 104 3e-22
sp|Q9LNP2|PPR47_ARATH Putative pentatricopeptide repeat-containi... 103 6e-22
sp|Q9LUS3|PP237_ARATH Pentatricopeptide repeat-containing protei... 103 6e-22

>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 127 bits (318), Expect = 5e-29
Identities = 66/184 (35%), Positives = 103/184 (55%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A FD + ++V++W +I+AC+ KA M LP+ T+C
Sbjct: 230 QCGELTSALRAFDMMEEKDVISWTAVISACSRKGHGIKAIGMFIGMLNHWFLPNEFTVCS 289

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK CS A+ GR +H VK I D VG +L+ +YAKCG D RKV D M+NR+
Sbjct: 290 ILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDMYAKCGEISDCRKVFDGMSNRN 349

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
V WT++I ++ GFG+EA+ M + AN++T+ S LRAC +V + ++ +++H
Sbjct: 350 TVTWTSIIAAHAREGFGEEAISLFRIMKRRHLIANNLTVVSILRACGSVGALLLG-KELH 408

Query: 24 AEIV 13
A+I+
Sbjct: 409 AQII 412



Score = 114 bits (285), Expect = 3e-25
Identities = 63/181 (34%), Positives = 96/181 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + VFD + RN VTW +I A F E+A M ++ +++T+
Sbjct: 331 KCGEISDCRKVFDGMSNRNTVTWTSIIAAHAREGFGEEAISLFRIMKRRHLIANNLTVVS 390

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L+ C +GA+ G+ +H + +K I+ + +G+ L+ LY KCG DA VL ++ +RD
Sbjct: 391 ILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLYCKCGESRDAFNVLQQLPSRD 450

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
VV+WT +I G S G EAL L EM E V N T S+L+AC S ++ R IH
Sbjct: 451 VVSWTAMISGCSSLGHESEALDFLKEMIQEGVEPNPFTYSSALKACANSESLLIG-RSIH 509

Query: 24 A 22
+
Sbjct: 510 S 510



Score = 104 bits (259), Expect = 3e-22
Identities = 54/166 (32%), Positives = 89/166 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C +A+ V LP R+VV+W +I+ C+ + +A +++M EGV P+ T
Sbjct: 432 KCGESRDAFNVLQQLPSRDVVSWTAMISGCSSLGHESEALDFLKEMIQEGVEPNPFTYSS 491

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+ ++ GR+IH A K + VG+AL+ +YAKCG +A +V D M ++
Sbjct: 492 ALKACANSESLLIGRSIHSIAKKNHALSNVFVGSALIHMYAKCGFVSEAFRVFDSMPEKN 551

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
+V+W +I GY+ +GF +EAL + M E + + L C
Sbjct: 552 LVSWKAMIMGYARNGFCREALKLMYRMEAEGFEVDDYIFATILSTC 597



Score = 87.8 bits (216), Expect = 3e-17
Identities = 57/187 (30%), Positives = 88/187 (47%), Gaps = 1/187 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGV-LPSSITLC 388
R V A VFD++P +N VTW +I +++A E G+ +
Sbjct: 129 RLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGLEDEAFALFEDYVKHGIRFTNERMFV 188

Query: 387 CTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANR 208
C L CSR E GR +H VK G+ G+ V ++L+ YA+CG A + D M +
Sbjct: 189 CLLNLCSRRAEFELGRQVHGNMVKVGV-GNLIVESSLVYFYAQCGELTSALRAFDMMEEK 247

Query: 207 DVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQI 28
DV++WT +I S G G +A+ M N T+ S L+AC + + RQ+
Sbjct: 248 DVISWTAVISACSRKGHGIKAIGMFIGMLNHWFLPNEFTVCSILKAC-SEEKALRFGRQV 306

Query: 27 HAEIVNK 7
H+ +V +
Sbjct: 307 HSLVVKR 313



Score = 45.8 bits (107), Expect = 1e-04
Identities = 25/66 (37%), Positives = 35/66 (53%)
Frame = -1

Query: 342 RTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEH 163
+ IH A+K D GN L+S + G + ARKV D M ++ V WT +I GY ++
Sbjct: 102 KRIHAMALKCFDDQVIYFGNNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKY 161

Query: 162 GFGKEA 145
G EA
Sbjct: 162 GLEDEA 167



Score = 37.7 bits (86), Expect = 0.040
Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 3/82 (3%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C EA+ VFD++P +N+V+W +I + F +A + +M EG
Sbjct: 533 KCGFVSEAFRVFDSMPEKNLVSWKAMIMGYARNGFCREALKLMYRMEAEGFEVDDYIFAT 592

Query: 384 TLKCCSRI---GAIERGRTIHI 328
L C I A+E T ++
Sbjct: 593 ILSTCGDIELDEAVESSATCYL 614


>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein
At3g24000, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H87 PE=2 SV=1
Length = 633

Score = 116 bits (291), Expect = 7e-26
Identities = 63/160 (39%), Positives = 84/160 (52%)
Frame = -1

Query: 546 EAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCS 367
+A VFD L RN V+WN LI EKA + M +G PS + CS
Sbjct: 214 DAQLVFDALESRNDVSWNALIAGHARRSGTEKALELFQGMLRDGFRPSHFSYASLFGACS 273

Query: 366 RIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTT 187
G +E+G+ +H +K G GN LL +YAK G DARK+ D +A RDVV+W +
Sbjct: 274 STGFLEQGKWVHAYMIKSGEKLVAFAGNTLLDMYAKSGSIHDARKIFDRLAKRDVVSWNS 333

Query: 186 LIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
L+ Y++HGFGKEA+ EM + N I+ S L AC
Sbjct: 334 LLTAYAQHGFGKEAVWWFEEMRRVGIRPNEISFLSVLTAC 373



Score = 82.8 bits (203), Expect = 1e-15
Identities = 47/127 (37%), Positives = 66/127 (51%)
Frame = -1

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
LK C+ + +GR +H ++ D +GN LL++YAKCG +ARKV ++M RD
Sbjct: 67 LKKCTVFKLLIQGRIVHAHILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMPQRDF 126

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHA 22
V WTTLI GYS+H +AL+ +M S N TL S ++A Q+H
Sbjct: 127 VTWTTLISGYSQHDRPCDALLFFNQMLRFGYSPNEFTLSSVIKAAAAERRGCCG-HQLHG 185

Query: 21 EIVNKGF 1
V GF
Sbjct: 186 FCVKCGF 192



Score = 80.5 bits (197), Expect = 5e-15
Identities = 55/187 (29%), Positives = 87/187 (46%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S EA VF+ +P R+ VTW LI+ + + A QM G P+ TL
Sbjct: 107 KCGSLEEARKVFEKMPQRDFVTWTTLISGYSQHDRPCDALLFFNQMLRFGYSPNEFTLSS 166

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
+K + G +H VK G D + VG+ALL LY + GL DA+ V D + +R+
Sbjct: 167 VIKAAAAERRGCCGHQLHGFCVKCGFDSNVHVGSALLDLYTRYGLMDDAQLVFDALESRN 226

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
V+W LI G++ ++AL M + + + S AC + + + +H
Sbjct: 227 DVSWNALIAGHARRSGTEKALELFQGMLRDGFRPSHFSYASLFGACSSTGF-LEQGKWVH 285

Query: 24 AEIVNKG 4
A ++ G
Sbjct: 286 AYMIKSG 292



Score = 55.8 bits (133), Expect = 1e-07
Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 1/135 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+ S +A +FD L R+VV+WN L+TA F ++A E+M G+ P+ I+
Sbjct: 309 KSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQHGFGKEAVWWFEEMRRVGIRPNEISFLS 368

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L CS G ++ G + K+GI + ++ L + G A + ++EM
Sbjct: 369 VLTACSHSGLLDEGWHYYELMKKDGIVPEAWHYVTVVDLLGRAGDLNRALRFIEEMPIEP 428

Query: 204 VVA-WTTLIGGYSEH 163
A W L+ H
Sbjct: 429 TAAIWKALLNACRMH 443


>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein
At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1
Length = 596

Score = 116 bits (290), Expect = 9e-26
Identities = 57/166 (34%), Positives = 86/166 (51%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C+ + +A VFD +P RNVVTW LI S +K E+M V P+ TL
Sbjct: 252 KCSCYDDAQKVFDEMPSRNVVTWTALIAGYVQSRCFDKGMLVFEEMLKSDVAPNEKTLSS 311

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ +GA+ RGR +H +K I+ + G L+ LY KCG +A V + + ++
Sbjct: 312 VLSACAHVGALHRGRRVHCYMIKNSIEINTTAGTTLIDLYVKCGCLEEAILVFERLHEKN 371

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
V WT +I G++ HG+ ++A M VS N +T + L AC
Sbjct: 372 VYTWTAMINGFAAHGYARDAFDLFYTMLSSHVSPNEVTFMAVLSAC 417



Score = 90.5 bits (223), Expect = 5e-18
Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 1/175 (0%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
+FD ++VVTW +I + +A +M GV + +T+ LK ++
Sbjct: 160 LFDGAEDKDVVTWTAMIDGFVRNGSASEAMVYFVEMKKTGVAANEMTVVSVLKAAGKVED 219

Query: 354 IERGRTIHIRAVKEG-IDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIG 178
+ GR++H ++ G + D +G++L+ +Y KC + DA+KV DEM +R+VV WT LI
Sbjct: 220 VRFGRSVHGLYLETGRVKCDVFIGSSLVDMYGKCSCYDDAQKVFDEMPSRNVVTWTALIA 279

Query: 177 GYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIV 13
GY + + ++ EM V+ N TL S L AC V + + R++H ++
Sbjct: 280 GYVQSRCFDKGMLVFEEMLKSDVAPNEKTLSSVLSACAHVGA-LHRGRRVHCYMI 333



Score = 68.2 bits (165), Expect = 3e-11
Identities = 43/120 (35%), Positives = 64/120 (53%)
Frame = -1

Query: 429 MALEGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGL 250
M GV+PS T LK ++ + H VK G+D D V N+L+S Y+ GL
Sbjct: 95 MRRNGVIPSRHTFPPLLKAVFKLRDSNPFQ-FHAHIVKFGLDSDPFVRNSLISGYSSSGL 153

Query: 249 FLDARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRA 70
F A ++ D ++DVV WT +I G+ +G EA++ EM V+AN +T+ S L+A
Sbjct: 154 FDFASRLFDGAEDKDVVTWTAMIDGFVRNGSASEAMVYFVEMKKTGVAANEMTVVSVLKA 213



Score = 50.1 bits (118), Expect = 8e-06
Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 8/148 (5%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C EA VF+ L +NV TW +I + A M V P+ +T
Sbjct: 353 KCGCLEEAILVFERLHEKNVYTWTAMINGFAAHGYARDAFDLFYTMLSSHVSPNEVTFMA 412

Query: 384 TLKCCSRIGAIERGRTIHI----RAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEM 217
L C+ G +E GR + + R E YA ++ L+ + GL +A+ +++ M
Sbjct: 413 VLSACAHGGLVEEGRRLFLSMKGRFNMEPKADHYA---CMVDLFGRKGLLEEAKALIERM 469

Query: 216 ANRDV-VAWTTLIGG---YSEHGFGKEA 145
V W L G + ++ GK A
Sbjct: 470 PMEPTNVVWGALFGSCLLHKDYELGKYA 497


>sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein
At1g15510, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H73 PE=2 SV=1
Length = 866

Score = 115 bits (289), Expect = 1e-25
Identities = 63/189 (33%), Positives = 96/189 (50%), Gaps = 1/189 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITA-CTDSEFDEKAAHCIEQMALEGVLPSSITLC 388
R + V+AW+VF + RN+ +WN+L+ FDE + + GV P T
Sbjct: 141 RFGNLVDAWYVFGKMSERNLFSWNVLVGGYAKQGYFDEAMCLYHRMLWVGGVKPDVYTFP 200

Query: 387 CTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANR 208
C L+ C I + RG+ +H+ V+ G + D V NAL+++Y KCG AR + D M R
Sbjct: 201 CVLRTCGGIPDLARGKEVHVHVVRYGYELDIDVVNALITMYVKCGDVKSARLLFDRMPRR 260

Query: 207 DVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQI 28
D+++W +I GY E+G E L M V + +TL S + AC + + R I
Sbjct: 261 DIISWNAMISGYFENGMCHEGLELFFAMRGLSVDPDLMTLTSVISACELLGDRRLG-RDI 319

Query: 27 HAEIVNKGF 1
HA ++ GF
Sbjct: 320 HAYVITTGF 328



Score = 88.6 bits (218), Expect = 2e-17
Identities = 47/169 (27%), Positives = 81/169 (47%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A +FD +P R++++WN +I+ ++ + M V P +TL
Sbjct: 243 KCGDVKSARLLFDRMPRRDIISWNAMISGYFENGMCHEGLELFFAMRGLSVDPDLMTLTS 302

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
+ C +G GR IH + G D +V N+L +Y G + +A K+ M +D
Sbjct: 303 VISACELLGDRRLGRDIHAYVITTGFAVDISVCNSLTQMYLNAGSWREAEKLFSRMERKD 362

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITV 58
+V+WTT+I GY + +A+ M + V + IT+ + L AC T+
Sbjct: 363 IVSWTTMISGYEYNFLPDKAIDTYRMMDQDSVKPDEITVAAVLSACATL 411



Score = 86.3 bits (212), Expect = 1e-16
Identities = 49/184 (26%), Positives = 96/184 (52%)
Frame = -1

Query: 555 SFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLK 376
S+ EA +F + +++V+W +I+ + +KA M + V P IT+ L
Sbjct: 347 SWREAEKLFSRMERKDIVSWTTMISGYEYNFLPDKAIDTYRMMDQDSVKPDEITVAAVLS 406

Query: 375 CCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVA 196
C+ +G ++ G +H A+K + V N L+++Y+KC A + + ++V++
Sbjct: 407 ACATLGDLDTGVELHKLAIKARLISYVIVANNLINMYSKCKCIDKALDIFHNIPRKNVIS 466

Query: 195 WTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEI 16
WT++I G + EAL+ L +M + + N+ITL ++L AC + + + ++IHA +
Sbjct: 467 WTSIIAGLRLNNRCFEALIFLRQMKM-TLQPNAITLTAALAACARIGALMCG-KEIHAHV 524

Query: 15 VNKG 4
+ G
Sbjct: 525 LRTG 528



Score = 85.5 bits (210), Expect = 2e-16
Identities = 51/166 (30%), Positives = 82/166 (49%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C +A +F +P +NV++W +I + +A + QM + + P++ITL
Sbjct: 445 KCKCIDKALDIFHNIPRKNVISWTSIIAGLRLNNRCFEALIFLRQMKMT-LQPNAITLTA 503

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+RIGA+ G+ IH ++ G+ D + NALL +Y +CG A + +D
Sbjct: 504 ALAACARIGALMCGKEIHAHVLRTGVGLDDFLPNALLDMYVRCGRMNTAWSQFNSQ-KKD 562

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
V +W L+ GYSE G G + M +V + IT S L C
Sbjct: 563 VTSWNILLTGYSERGQGSMVVELFDRMVKSRVRPDEITFISLLCGC 608



Score = 55.1 bits (131), Expect = 2e-07
Identities = 38/154 (24%), Positives = 70/154 (45%), Gaps = 2/154 (1%)
Frame = -1

Query: 456 EKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNAL 277
E+A + M V ++ C A E G ++ A+ +GNA
Sbjct: 76 EEAMKLLNSMQELRVAVDEDVFVALVRLCEWKRAQEEGSKVYSIALSSMSSLGVELGNAF 135

Query: 276 LSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGE--MHLEKVSA 103
L+++ + G +DA V +M+ R++ +W L+GGY++ G+ EA MCL + + V
Sbjct: 136 LAMFVRFGNLVDAWYVFGKMSERNLFSWNVLVGGYAKQGYFDEA-MCLYHRMLWVGGVKP 194

Query: 102 NSITLDSSLRACITVSSPIVNIRQIHAEIVNKGF 1
+ T LR C + + +++H +V G+
Sbjct: 195 DVYTFPCVLRTCGGIPD-LARGKEVHVHVVRYGY 227



Score = 43.1 bits (100), Expect = 0.001
Identities = 30/135 (22%), Positives = 53/135 (39%), Gaps = 1/135 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC AW F++ ++V +WNIL+T ++ ++M V P IT
Sbjct: 545 RCGRMNTAWSQFNSQK-KDVTSWNILLTGYSERGQGSMVVELFDRMVKSRVRPDEITFIS 603

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEM-ANR 208
L CS+ + +G + G+ + ++ L + G +A K + +M
Sbjct: 604 LLCGCSKSQMVRQGLMYFSKMEDYGVTPNLKHYACVVDLLGRAGELQEAHKFIQKMPVTP 663

Query: 207 DVVAWTTLIGGYSEH 163
D W L+ H
Sbjct: 664 DPAVWGALLNACRIH 678


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 115 bits (287), Expect = 2e-25
Identities = 57/167 (34%), Positives = 93/167 (55%), Gaps = 1/167 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVL-PSSITLC 388
+C S EA VF + V+++++WN +I + + + +A + E P T+
Sbjct: 444 KCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVA 503

Query: 387 CTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANR 208
C L C+ + A ++GR IH ++ G D V N+L+ +YAKCG L A + D++A++
Sbjct: 504 CVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASK 563

Query: 207 DVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
D+V+WT +I GY HGFGKEA+ +M + A+ I+ S L AC
Sbjct: 564 DLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVSLLYAC 610



Score = 102 bits (253), Expect = 2e-21
Identities = 59/189 (31%), Positives = 96/189 (50%), Gaps = 1/189 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF + R+VV++ +I +A E+M EG+ P T+
Sbjct: 343 KCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGISPDVYTVTA 402

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L CC+R ++ G+ +H + + D V NAL+ +YAKCG +A V EM +D
Sbjct: 403 VLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAELVFSEMRVKD 462

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEK-VSANSITLDSSLRACITVSSPIVNIRQI 28
+++W T+IGGYS++ + EAL + EK S + T+ L AC ++S+ R+I
Sbjct: 463 IISWNTIIGGYSKNCYANEALSLFNLLLEEKRFSPDERTVACVLPACASLSA-FDKGREI 521

Query: 27 HAEIVNKGF 1
H I+ G+
Sbjct: 522 HGYIMRNGY 530



Score = 88.2 bits (217), Expect = 3e-17
Identities = 49/156 (31%), Positives = 76/156 (48%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD + R+V++WN +I + EK QM + G+ T+ C+
Sbjct: 252 VFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRL 311

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
I GR +H VK + N LL +Y+KCG A+ V EM++R VV++T++I G
Sbjct: 312 ISLGRAVHSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAG 371

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
Y+ G EA+ EM E +S + T+ + L C
Sbjct: 372 YAREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCC 407



Score = 87.0 bits (214), Expect = 6e-17
Identities = 52/181 (28%), Positives = 86/181 (47%), Gaps = 1/181 (0%)
Frame = -1

Query: 561 CASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCT 382
C EA VFD + + + WNIL+ S + ++M GV S T C
Sbjct: 142 CGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGLFKKMMSSGVEMDSYTFSCV 201

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
K S + ++ G +H +K G +VGN+L++ Y K ARKV DEM RDV
Sbjct: 202 SKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDV 261

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNI-RQIH 25
++W ++I GY +G ++ L +M + + + T+ S C S ++++ R +H
Sbjct: 262 ISWNSIINGYVSNGLAEKGLSVFVQMLVSGIEIDLATIVSVFAGC--ADSRLISLGRAVH 319

Query: 24 A 22
+
Sbjct: 320 S 320



Score = 43.9 bits (102), Expect = 6e-04
Identities = 31/136 (22%), Positives = 64/136 (47%), Gaps = 4/136 (2%)
Frame = -1

Query: 396 TLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEM 217
TLC L+ C+ +++ G+ + G D +G+ L +Y CG +A +V DE+
Sbjct: 96 TLCSVLQLCADSKSLKDGKEVDNFIRGNGFVIDSNLGSKLSLMYTNCGDLKEASRVFDEV 155

Query: 216 ANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVS-SPIVN 40
+ W L+ ++ G ++ +K+ ++ + +DS +C++ S S + +
Sbjct: 156 KIEKALFWNILMNELAKSGDFSGSIGL-----FKKMMSSGVEMDSYTFSCVSKSFSSLRS 210

Query: 39 I---RQIHAEIVNKGF 1
+ Q+H I+ GF
Sbjct: 211 VHGGEQLHGFILKSGF 226



Score = 43.5 bits (101), Expect = 7e-04
Identities = 30/136 (22%), Positives = 59/136 (43%), Gaps = 2/136 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + + A +FD + +++V+W ++I F ++A QM G+ I+
Sbjct: 546 KCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVS 605

Query: 384 TLKCCSRIGAIERG-RTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEM-AN 211
L CS G ++ G R +I + I+ ++ + A+ G + A + ++ M
Sbjct: 606 LLYACSHSGLVDEGWRFFNIMRHECKIEPTVEHYACIVDMLARTGDLIKAYRFIENMPIP 665

Query: 210 RDVVAWTTLIGGYSEH 163
D W L+ G H
Sbjct: 666 PDATIWGALLCGCRIH 681


>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein
At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=2 SV=1
Length = 990

Score = 114 bits (285), Expect = 3e-25
Identities = 60/185 (32%), Positives = 95/185 (51%), Gaps = 3/185 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A + FD++PV + V W +I+ C ++ +E+A H QM L GVLP T+
Sbjct: 564 KCGDMSAAQFAFDSIPVPDDVAWTTMISGCIENGEEERAFHVFSQMRLMGVLPDEFTIAT 623

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
K S + A+E+GR IH A+K D VG +L+ +YAKCG DA + + +
Sbjct: 624 LAKASSCLTALEQGRQIHANALKLNCTNDPFVGTSLVDMYAKCGSIDDAYCLFKRIEMMN 683

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACI---TVSSPIVNIR 34
+ AW ++ G ++HG GKE L +M + + +T L AC VS ++R
Sbjct: 684 ITAWNAMLVGLAQHGEGKETLQLFKQMKSLGIKPDKVTFIGVLSACSHSGLVSEAYKHMR 743

Query: 33 QIHAE 19
+H +
Sbjct: 744 SMHGD 748



Score = 89.0 bits (219), Expect = 2e-17
Identities = 56/166 (33%), Positives = 82/166 (49%), Gaps = 7/166 (4%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMAL-------EGVLP 406
+C S A VFD +P R++V+WN ++ A S E I+Q L + V
Sbjct: 86 KCGSLTYARRVFDKMPDRDLVSWNSILAAYAQSS--ECVVENIQQAFLLFRILRQDVVYT 143

Query: 405 SSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVL 226
S +TL LK C G + + H A K G+DGD V AL+++Y K G + + +
Sbjct: 144 SRMTLSPMLKLCLHSGYVWASESFHGYACKIGLDGDEFVAGALVNIYLKFGKVKEGKVLF 203

Query: 225 DEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITL 88
+EM RDVV W ++ Y E GF +EA+ H ++ N ITL
Sbjct: 204 EEMPYRDVVLWNLMLKAYLEMGFKEEAIDLSSAFHSSGLNPNEITL 249



Score = 84.0 bits (206), Expect = 5e-16
Identities = 52/165 (31%), Positives = 77/165 (46%), Gaps = 2/165 (1%)
Frame = -1

Query: 510 NVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIH 331
++V WN ++ T S K M +G TL K C + AI +G+ +H
Sbjct: 481 DLVAWNAMMAGYTQSHDGHKTLKLFALMHKQGERSDDFTLATVFKTCGFLFAINQGKQVH 540

Query: 330 IRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEHGFGK 151
A+K G D D V + +L +Y KCG A+ D + D VAWTT+I G E+G +
Sbjct: 541 AYAIKSGYDLDLWVSSGILDMYVKCGDMSAAQFAFDSIPVPDDVAWTTMISGCIENGEEE 600

Query: 150 EALMCLGEMHLEKVSANSITLDSSLRA--CITVSSPIVNIRQIHA 22
A +M L V + T+ + +A C+T + RQIHA
Sbjct: 601 RAFHVFSQMRLMGVLPDEFTIATLAKASSCLTA---LEQGRQIHA 642



Score = 73.6 bits (179), Expect = 7e-13
Identities = 45/179 (25%), Positives = 86/179 (48%), Gaps = 1/179 (0%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIG- 358
VFD + R++++WN +I + + +A Q+ G+ P T+ LK S +
Sbjct: 372 VFDNMSERDLISWNSVIAGIAQNGLEVEAVCLFMQLLRCGLKPDQYTMTSVLKAASSLPE 431

Query: 357 AIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIG 178
+ + +H+ A+K D V AL+ Y++ +A ++L E N D+VAW ++
Sbjct: 432 GLSLSKQVHVHAIKINNVSDSFVSTALIDAYSRNRCMKEA-EILFERHNFDLVAWNAMMA 490

Query: 177 GYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKGF 1
GY++ G + L MH + ++ TL + + C + + I +Q+HA + G+
Sbjct: 491 GYTQSHDGHKTLKLFALMHKQGERSDDFTLATVFKTCGFLFA-INQGKQVHAYAIKSGY 548



Score = 68.6 bits (166), Expect = 2e-11
Identities = 36/143 (25%), Positives = 71/143 (49%)
Frame = -1

Query: 441 CIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYA 262
C M V +T L ++ ++ G+ +H A+K G+D V N+L+++Y
Sbjct: 302 CFADMVESDVECDQVTFILMLATAVKVDSLALGQQVHCMALKLGLDLMLTVSNSLINMYC 361

Query: 261 KCGLFLDARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDS 82
K F AR V D M+ RD+++W ++I G +++G EA+ ++ + + T+ S
Sbjct: 362 KLRKFGFARTVFDNMSERDLISWNSVIAGIAQNGLEVEAVCLFMQLLRCGLKPDQYTMTS 421

Query: 81 SLRACITVSSPIVNIRQIHAEIV 13
L+A ++ + +Q+H +
Sbjct: 422 VLKAASSLPEGLSLSKQVHVHAI 444



Score = 49.7 bits (117), Expect = 1e-05
Identities = 26/99 (26%), Positives = 53/99 (53%), Gaps = 5/99 (5%)
Frame = -1

Query: 345 GRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSE 166
G+ H R + + + + N L+S+Y+KCG AR+V D+M +RD+V+W +++ Y++
Sbjct: 58 GKCTHARILTFEENPERFLINNLISMYSKCGSLTYARRVFDKMPDRDLVSWNSILAAYAQ 117

Query: 165 HGFG-----KEALMCLGEMHLEKVSANSITLDSSLRACI 64
++A + + + V + +TL L+ C+
Sbjct: 118 SSECVVENIQQAFLLFRILRQDVVYTSRMTLSPMLKLCL 156


>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein
At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=2 SV=1
Length = 781

Score = 111 bits (277), Expect = 3e-24
Identities = 60/166 (36%), Positives = 88/166 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C EA +FD +P R+ V+W +I + S +A QM EG + +
Sbjct: 355 QCGKISEAKNLFDKMPKRDPVSWAAMIAGYSQSGHSFEALRLFVQMEREGGRLNRSSFSS 414

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ + A+E G+ +H R VK G + VGNALL +Y KCG +A + EMA +D
Sbjct: 415 ALSTCADVVALELGKQLHGRLVKGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKD 474

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
+V+W T+I GYS HGFG+ AL M E + + T+ + L AC
Sbjct: 475 IVSWNTMIAGYSRHGFGEVALRFFESMKREGLKPDDATMVAVLSAC 520



Score = 71.2 bits (173), Expect = 3e-12
Identities = 49/186 (26%), Positives = 86/186 (46%), Gaps = 4/186 (2%)
Frame = -1

Query: 546 EAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCS 367
EA +FD PV++V TW +++ + E+A ++M + + L
Sbjct: 268 EARQLFDESPVQDVFTWTAMVSGYIQNRMVEEARELFDKMPERNEVSWNAMLA------- 320

Query: 366 RIGAIERGRTIHIRAVKEGID----GDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVV 199
G ++ R + KE D + + N +++ YA+CG +A+ + D+M RD V
Sbjct: 321 --GYVQGER---MEMAKELFDVMPCRNVSTWNTMITGYAQCGKISEAKNLFDKMPKRDPV 375

Query: 198 AWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAE 19
+W +I GYS+ G EAL +M E N + S+L C V + + +Q+H
Sbjct: 376 SWAAMIAGYSQSGHSFEALRLFVQMEREGGRLNRSSFSSALSTCADVVALELG-KQLHGR 434

Query: 18 IVNKGF 1
+V G+
Sbjct: 435 LVKGGY 440



Score = 65.1 bits (157), Expect = 2e-10
Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 2/137 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S EA +F + +++V+WN +I + F E A E M EG+ P T+
Sbjct: 456 KCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEVALRFFESMKREGLKPDDATMVA 515

Query: 384 TLKCCSRIGAIERGRTIHIRAVKE-GIDGDYAVGNALLSLYAKCGLFLDARKVLDEMA-N 211
L CS G +++GR ++ G+ + ++ L + GL DA ++ M
Sbjct: 516 VLSACSHTGLVDKGRQYFYTMTQDYGVMPNSQHYACMVDLLGRAGLLEDAHNLMKNMPFE 575

Query: 210 RDVVAWTTLIGGYSEHG 160
D W TL+G HG
Sbjct: 576 PDAAIWGTLLGASRVHG 592



Score = 51.2 bits (121), Expect = 3e-06
Identities = 32/131 (24%), Positives = 64/131 (48%), Gaps = 1/131 (0%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD +P +N V+WN L++A + E+A + ++ + C G
Sbjct: 179 VFDRMPEKNDVSWNALLSAYVQNSKMEEACMLFKSRENWALVSWN---------CLLGGF 229

Query: 354 IERGRTIHIRAVKEGID-GDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIG 178
+++ + + R + ++ D N +++ YA+ G +AR++ DE +DV WT ++
Sbjct: 230 VKKKKIVEARQFFDSMNVRDVVSWNTIITGYAQSGKIDEARQLFDESPVQDVFTWTAMVS 289

Query: 177 GYSEHGFGKEA 145
GY ++ +EA
Sbjct: 290 GYIQNRMVEEA 300



Score = 46.6 bits (109), Expect = 9e-05
Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 31/183 (16%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
R F A +FD +P R++V+WN++I + KA E M V + L
Sbjct: 107 RNGEFELARKLFDEMPERDLVSWNVMIKGYVRNRNLGKARELFEIMPERDVCSWNTML-- 164

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAK-------CGLF------- 247
++ G ++ R++ R + E D + NALLS Y + C LF
Sbjct: 165 --SGYAQNGCVDDARSVFDR-MPEKNDVSW---NALLSAYVQNSKMEEACMLFKSRENWA 218

Query: 246 -----------------LDARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHL 118
++AR+ D M RDVV+W T+I GY++ G EA E +
Sbjct: 219 LVSWNCLLGGFVKKKKIVEARQFFDSMNVRDVVSWNTIITGYAQSGKIDEARQLFDESPV 278

Query: 117 EKV 109
+ V
Sbjct: 279 QDV 281



Score = 40.0 bits (92), Expect = 0.008
Identities = 18/38 (47%), Positives = 25/38 (65%)
Frame = -1

Query: 285 NALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGY 172
N ++S Y + G F ARK+ DEM RD+V+W +I GY
Sbjct: 99 NGMISGYLRNGEFELARKLFDEMPERDLVSWNVMIKGY 136



Score = 35.4 bits (80), Expect = 0.20
Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 2/119 (1%)
Frame = -1

Query: 510 NVVTWNILITACTDSEFDEKAAHCIEQMALEGVLP--SSITLCCTLKCCSRIGAIERGRT 337
++ WN+ I++ + C E + + +P SS++ + R G E R
Sbjct: 63 DIKEWNVAISSYM------RTGRCNEALRVFKRMPRWSSVSYNGMISGYLRNGEFELARK 116

Query: 336 IHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEHG 160
+ E + D N ++ Y + AR++ + M RDV +W T++ GY+++G
Sbjct: 117 LF----DEMPERDLVSWNVMIKGYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNG 171


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 110 bits (274), Expect = 6e-24
Identities = 60/190 (31%), Positives = 102/190 (53%), Gaps = 2/190 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + A+ VFD++P RNVV+W+ L++ + + + +M +G+ P+ T
Sbjct: 53 KCREPLMAYKVFDSMPERNVVSWSALMSGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFST 112

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C + A+E+G IH +K G + VGN+L+ +Y+KCG +A KV + +R
Sbjct: 113 NLKACGLLNALEKGLQIHGFCLKIGFEMMVEVGNSLVDMYSKCGRINEAEKVFRRIVDRS 172

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVS--ANSITLDSSLRACITVSSPIVNIRQ 31
+++W +I G+ G+G +AL G M + + TL S L+AC + + I +Q
Sbjct: 173 LISWNAMIAGFVHAGYGSKALDTFGMMQEANIKERPDEFTLTSLLKAC-SSTGMIYAGKQ 231

Query: 30 IHAEIVNKGF 1
IH +V GF
Sbjct: 232 IHGFLVRSGF 241



Score = 77.8 bits (190), Expect = 3e-14
Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 4/145 (2%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVL--PSSITL 391
+C EA VF + R++++WN +I + + KA M + P TL
Sbjct: 154 KCGRINEAEKVFRRIVDRSLISWNAMIAGFVHAGYGSKALDTFGMMQEANIKERPDEFTL 213

Query: 390 CCTLKCCSRIGAIERGRTIHIRAVKEGID--GDYAVGNALLSLYAKCGLFLDARKVLDEM 217
LK CS G I G+ IH V+ G + +L+ LY KCG ARK D++
Sbjct: 214 TSLLKACSSTGMIYAGKQIHGFLVRSGFHCPSSATITGSLVDLYVKCGYLFSARKAFDQI 273

Query: 216 ANRDVVAWTTLIGGYSEHGFGKEAL 142
+ +++W++LI GY++ G EA+
Sbjct: 274 KEKTMISWSSLILGYAQEGEFVEAM 298



Score = 71.2 bits (173), Expect = 3e-12
Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 1/167 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITA-CTDSEFDEKAAHCIEQMALEGVLPSSITLC 388
+C A FD + + +++W+ LI + EF E L + S L
Sbjct: 259 KCGYLFSARKAFDQIKEKTMISWSSLILGYAQEGEFVEAMGLFKRLQELNSQI-DSFALS 317

Query: 387 CTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANR 208
+ + + +G+ + AVK + +V N+++ +Y KCGL +A K EM +
Sbjct: 318 SIIGVFADFALLRQGKQMQALAVKLPSGLETSVLNSVVDMYLKCGLVDEAEKCFAEMQLK 377

Query: 207 DVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
DV++WT +I GY +HG GK+++ EM + + + + L AC
Sbjct: 378 DVISWTVVITGYGKHGLGKKSVRIFYEMLRHNIEPDEVCYLAVLSAC 424



Score = 68.6 bits (166), Expect = 2e-11
Identities = 41/131 (31%), Positives = 67/131 (51%)
Frame = -1

Query: 393 LCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMA 214
L L+ C+R G ++G +H +K G + N L+ +Y KC L A KV D M
Sbjct: 9 LVSILRVCTRKGLSDQGGQVHCYLLKSGSGLNLITSNYLIDMYCKCREPLMAYKVFDSMP 68

Query: 213 NRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIR 34
R+VV+W+ L+ G+ +G K +L EM + + N T ++L+AC +++ +
Sbjct: 69 ERNVVSWSALMSGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFSTNLKACGLLNA-LEKGL 127

Query: 33 QIHAEIVNKGF 1
QIH + GF
Sbjct: 128 QIHGFCLKIGF 138


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 109 bits (273), Expect = 8e-24
Identities = 59/188 (31%), Positives = 102/188 (54%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + +A +F+ + R+ VTWN +I + E + +A ++M L G++ L
Sbjct: 475 KCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACLAS 534

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
TLK C+ + + +G+ +H +VK G+D D G++L+ +Y+KCG+ DARKV +
Sbjct: 535 TLKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWS 594

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
VV+ LI GYS++ +EA++ EM V+ + IT + + AC S + Q H
Sbjct: 595 VVSMNALIAGYSQNNL-EEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLG-TQFH 652

Query: 24 AEIVNKGF 1
+I +GF
Sbjct: 653 GQITKRGF 660



Score = 91.7 bits (226), Expect = 2e-18
Identities = 48/150 (32%), Positives = 79/150 (52%), Gaps = 1/150 (0%)
Frame = -1

Query: 513 RNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTI 334
+++V W +++ + + F E+A ++M +GVLP T L+ CS + ++ GR I
Sbjct: 695 KSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREGRAI 754

Query: 333 HIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANR-DVVAWTTLIGGYSEHGF 157
H D D N L+ +YAKCG + +V DEM R +VV+W +LI GY+++G+
Sbjct: 755 HSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGY 814

Query: 156 GKEALMCLGEMHLEKVSANSITLDSSLRAC 67
++AL M + + IT L AC
Sbjct: 815 AEDALKIFDSMRQSHIMPDEITFLGVLTAC 844



Score = 90.5 bits (223), Expect = 5e-18
Identities = 56/187 (29%), Positives = 84/187 (44%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF+ L +N V WN +I + K M G T
Sbjct: 374 KCEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNGESHKVMELFMDMKSSGYNIDDFTFTS 433

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ +E G H +K+ + + VGNAL+ +YAKCG DAR++ + M +RD
Sbjct: 434 LLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMCDRD 493

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
V W T+IG Y + EA M+L + ++ L S+L+AC V + +Q+H
Sbjct: 494 NVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACLASTLKACTHVHG-LYQGKQVH 552

Query: 24 AEIVNKG 4
V G
Sbjct: 553 CLSVKCG 559



Score = 80.1 bits (196), Expect = 7e-15
Identities = 56/186 (30%), Positives = 96/186 (51%), Gaps = 3/186 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C +A VF +LP +VV+ N LI + + +E A ++M GV PS IT
Sbjct: 576 KCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNLEE-AVVLFQEMLTRGVNPSEITFAT 634

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGI--DGDYAVGNALLSLYAKCGLFLDARKVLDEMAN 211
++ C + ++ G H + K G +G+Y +G +LL +Y +A + E+++
Sbjct: 635 IVEACHKPESLTLGTQFHGQITKRGFSSEGEY-LGISLLGMYMNSRGMTEACALFSELSS 693

Query: 210 -RDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIR 34
+ +V WT ++ G+S++GF +EAL EM + V + T + LR C +SS + R
Sbjct: 694 PKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSS-LREGR 752

Query: 33 QIHAEI 16
IH+ I
Sbjct: 753 AIHSLI 758



Score = 77.0 bits (188), Expect = 6e-14
Identities = 44/150 (29%), Positives = 71/150 (47%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+CA A FD L ++V WN +++ + K + + P+ T
Sbjct: 107 KCAQVSYAEKQFDFLE-KDVTAWNSMLSMYSSIGKPGKVLRSFVSLFENQIFPNKFTFSI 165

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+R +E GR IH +K G++ + G AL+ +YAKC DAR+V + + + +
Sbjct: 166 VLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPN 225

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLE 115
V WT L GY + G +EA++ M E
Sbjct: 226 TVCWTCLFSGYVKAGLPEEAVLVFERMRDE 255



Score = 70.1 bits (170), Expect = 7e-12
Identities = 45/186 (24%), Positives = 81/186 (43%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
R +A +F + +VV WN++I+ + A M V + TL
Sbjct: 273 RLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSVKSTRSTLGS 332

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L + ++ G +H A+K G+ + VG++L+S+Y+KC A KV + + ++
Sbjct: 333 VLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKN 392

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
V W +I GY+ +G + + +M + + T S L C S + Q H
Sbjct: 393 DVFWNAMIRGYAHNGESHKVMELFMDMKSSGYNIDDFTFTSLLSTC-AASHDLEMGSQFH 451

Query: 24 AEIVNK 7
+ I+ K
Sbjct: 452 SIIIKK 457



Score = 57.8 bits (138), Expect = 4e-08
Identities = 34/118 (28%), Positives = 57/118 (48%)
Frame = -1

Query: 357 AIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIG 178
A+ G+ +H +++ GID + +GNA++ LYAKC A K D +DV AW +++
Sbjct: 75 ALRIGKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFD-FLEKDVTAWNSMLS 133

Query: 177 GYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
YS G + L + ++ N T L C ++ + RQIH ++ G
Sbjct: 134 MYSSIGKPGKVLRSFVSLFENQIFPNKFTFSIVLSTCARETN-VEFGRQIHCSMIKMG 190



Score = 52.8 bits (125), Expect = 1e-06
Identities = 36/135 (26%), Positives = 60/135 (44%)
Frame = -1

Query: 408 PSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKV 229
P+++ C + G E + R EG D+ +++ Y + G DAR +
Sbjct: 224 PNTVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAFVTVINTYIRLGKLKDARLL 283

Query: 228 LDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSP 49
EM++ DVVAW +I G+ + G A+ M V + TL S L A V++
Sbjct: 284 FGEMSSPDVVAWNVMISGHGKRGCETVAIEYFFNMRKSSVKSTRSTLGSVLSAIGIVANL 343

Query: 48 IVNIRQIHAEIVNKG 4
+ + +HAE + G
Sbjct: 344 DLGL-VVHAEAIKLG 357



Score = 51.2 bits (121), Expect = 3e-06
Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 3/138 (2%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVR-NVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLC 388
+C + VFD + R NVV+WN LI + + E A + M ++P IT
Sbjct: 779 KCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQSHIMPDEITFL 838

Query: 387 CTLKCCSRIGAIERGRTIHIRAVKE-GIDGDYAVGNALLSLYAKCGLFLDARKVLD-EMA 214
L CS G + GR I + + GI+ ++ L + G +A ++ +
Sbjct: 839 GVLTACSHAGKVSDGRKIFEMMIGQYGIEARVDHVACMVDLLGRWGYLQEADDFIEAQNL 898

Query: 213 NRDVVAWTTLIGGYSEHG 160
D W++L+G HG
Sbjct: 899 KPDARLWSSLLGACRIHG 916


>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing
protein At1g69350, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E66 PE=3 SV=1
Length = 787

Score = 109 bits (273), Expect = 8e-24
Identities = 57/185 (30%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + + +F+ + +N V+W +I++ EF EKA +M G+ P+ +TL
Sbjct: 249 KCGDLLSSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYS 308

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDY-AVGNALLSLYAKCGLFLDARKVLDEMANR 208
L C IG I G+++H AV+ +D +Y ++ AL+ LYA+CG D VL +++R
Sbjct: 309 VLSSCGLIGLIREGKSVHGFAVRRELDPNYESLSLALVELYAECGKLSDCETVLRVVSDR 368

Query: 207 DVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQI 28
++VAW +LI Y+ G +AL +M +++ ++ TL SS+ AC + +QI
Sbjct: 369 NIVAWNSLISLYAHRGMVIQALGLFRQMVTQRIKPDAFTLASSISACENAGLVPLG-KQI 427

Query: 27 HAEIV 13
H ++
Sbjct: 428 HGHVI 432



Score = 106 bits (264), Expect = 9e-23
Identities = 48/156 (30%), Positives = 93/156 (59%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD +PVR++V W+ L+++C ++ KA + M +GV P ++T+ ++ C+ +G
Sbjct: 158 VFDGMPVRDLVAWSTLVSSCLENGEVVKALRMFKCMVDDGVEPDAVTMISVVEGCAELGC 217

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+ R++H + ++ D D + N+LL++Y+KCG L + ++ +++A ++ V+WT +I
Sbjct: 218 LRIARSVHGQITRKMFDLDETLCNSLLTMYSKCGDLLSSERIFEKIAKKNAVSWTAMISS 277

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
Y+ F ++AL EM + N +TL S L +C
Sbjct: 278 YNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSC 313



Score = 85.5 bits (210), Expect = 2e-16
Identities = 45/186 (24%), Positives = 91/186 (48%)
Frame = -1

Query: 561 CASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCT 382
C + V + RN+V WN LI+ +A QM + + P + TL +
Sbjct: 352 CGKLSDCETVLRVVSDRNIVAWNSLISLYAHRGMVIQALGLFRQMVTQRIKPDAFTLASS 411

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
+ C G + G+ IH ++ + ++ V N+L+ +Y+K G A V +++ +R V
Sbjct: 412 ISACENAGLVPLGKQIHGHVIRTDVSDEF-VQNSLIDMYSKSGSVDSASTVFNQIKHRSV 470

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHA 22
V W +++ G+S++G EA+ M+ + N +T + ++AC ++ S + + +H
Sbjct: 471 VTWNSMLCGFSQNGNSVEAISLFDYMYHSYLEMNEVTFLAVIQACSSIGS-LEKGKWVHH 529

Query: 21 EIVNKG 4
+++ G
Sbjct: 530 KLIISG 535



Score = 81.3 bits (199), Expect = 3e-15
Identities = 43/156 (27%), Positives = 78/156 (50%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VF+ + R+VVTWN ++ + + +A + M + + +T ++ CS IG+
Sbjct: 461 VFNQIKHRSVVTWNSMLCGFSQNGNSVEAISLFDYMYHSYLEMNEVTFLAVIQACSSIGS 520

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+E+G+ +H + + G+ D AL+ +YAKCG A V M++R +V+W+++I
Sbjct: 521 LEKGKWVHHKLIISGLK-DLFTDTALIDMYAKCGDLNAAETVFRAMSSRSIVSWSSMINA 579

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
Y HG A+ +M N + + L AC
Sbjct: 580 YGMHGRIGSAISTFNQMVESGTKPNEVVFMNVLSAC 615



Score = 70.5 bits (171), Expect = 6e-12
Identities = 50/181 (27%), Positives = 82/181 (45%), Gaps = 3/181 (1%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VF+ P + + +LI + A ++ E S L+ C+ G+
Sbjct: 56 VFEAFPYPDSFMYGVLIKCNVWCHLLDAAIDLYHRLVSETTQISKFVFPSVLRACA--GS 113

Query: 354 IER---GRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTL 184
E G +H R +K G+D D + +LL +Y + G DA KV D M RD+VAW+TL
Sbjct: 114 REHLSVGGKVHGRIIKGGVDDDAVIETSLLCMYGQTGNLSDAEKVFDGMPVRDLVAWSTL 173

Query: 183 IGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
+ E+G +AL M + V +++T+ S + C + + R +H +I K
Sbjct: 174 VSSCLENGEVVKALRMFKCMVDDGVEPDAVTMISVVEGCAELGCLRI-ARSVHGQITRKM 232

Query: 3 F 1
F
Sbjct: 233 F 233



Score = 30.8 bits (68), Expect = 4.9
Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 4/125 (3%)
Frame = -1

Query: 510 NVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIH 331
N V + +++AC S E+ + M GV P+S C + SR G ++
Sbjct: 604 NEVVFMNVLSACGHSGSVEEGKYYFNLMKSFGVSPNSEHFACFIDLLSRSGDLKEA---- 659

Query: 330 IRAVKE-GIDGDYAVGNALLS---LYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEH 163
R +KE D +V +L++ ++ K + + L ++ D +T L Y+E
Sbjct: 660 YRTIKEMPFLADASVWGSLVNGCRIHQKMDIIKAIKNDLSDIVTDDTGYYTLLSNIYAEE 719

Query: 162 GFGKE 148
G +E
Sbjct: 720 GEWEE 724


tr_hit_id A9T8E9
Definition tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 189
Score (bit) 137.0
E-value 5.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920440|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_B03.
(564 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 137 5e-31
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 134 3e-30
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 132 1e-29
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 129 1e-28
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 129 1e-28
tr|Q60DN6|Q60DN6_ORYSJ Os03g0644200 protein OS=Oryza sativa subs... 128 2e-28
tr|B6SWY6|B6SWY6_MAIZE Pentatricopeptide repeat protein PPR1106-... 128 2e-28
tr|A3AKS8|A3AKS8_ORYSJ Putative uncharacterized protein OS=Oryza... 128 2e-28
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 126 7e-28
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 124 3e-27
tr|A7Q1A2|A7Q1A2_VITVI Chromosome chr10 scaffold_43, whole genom... 124 3e-27
tr|A2XK21|A2XK21_ORYSI Putative uncharacterized protein OS=Oryza... 123 6e-27
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 122 1e-26
tr|A7NV40|A7NV40_VITVI Chromosome chr18 scaffold_1, whole genome... 122 2e-26
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 121 2e-26
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 121 2e-26
tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 120 5e-26
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 120 5e-26
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 120 5e-26
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 119 9e-26
tr|A7Q3S4|A7Q3S4_VITVI Chromosome chr13 scaffold_48, whole genom... 119 9e-26
tr|A7PH47|A7PH47_VITVI Chromosome chr17 scaffold_16, whole genom... 119 1e-25
tr|Q2QWV0|Q2QWV0_ORYSJ Os12g0181900 protein OS=Oryza sativa subs... 118 3e-25
tr|A2ZIP8|A2ZIP8_ORYSI Putative uncharacterized protein OS=Oryza... 118 3e-25
tr|A7PPE3|A7PPE3_VITVI Chromosome chr8 scaffold_23, whole genome... 117 3e-25
tr|A5AR18|A5AR18_VITVI Putative uncharacterized protein OS=Vitis... 117 3e-25
tr|Q6K2P5|Q6K2P5_ORYSJ Os09g0327200 protein OS=Oryza sativa subs... 117 4e-25
tr|A7P3N5|A7P3N5_VITVI Chromosome chr1 scaffold_5, whole genome ... 117 4e-25

>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 137 bits (344), Expect = 5e-31
Identities = 73/189 (38%), Positives = 104/189 (55%), Gaps = 2/189 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S+ + VF+ L R+++ WN +I + + E+A+ QM EGV+P+ IT
Sbjct: 274 KCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNKITYVI 333

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C A+ G+ IH R K G D V NAL+S+Y++CG DAR V D+M +D
Sbjct: 334 LLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKMVRKD 393

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNI--RQ 31
V++WT +IGG ++ GFG EAL EM V N +T S L AC SSP R+
Sbjct: 394 VISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNAC---SSPAALEWGRR 450

Query: 30 IHAEIVNKG 4
IH ++V G
Sbjct: 451 IHQQVVEAG 459



Score = 132 bits (331), Expect = 2e-29
Identities = 70/188 (37%), Positives = 106/188 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S EA VFD + ++VV+W I I D E A ++M EGV+P+ IT
Sbjct: 173 KCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYIS 232

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L S A++ G+ +H R + G + D AVG AL+ +YAKCG + D R+V +++ NRD
Sbjct: 233 VLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRD 292

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
++AW T+IGG +E G+ +EA +M E V N IT L AC+ S+ + ++IH
Sbjct: 293 LIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVN-SAALHWGKEIH 351

Query: 24 AEIVNKGF 1
+ + GF
Sbjct: 352 SRVAKAGF 359



Score = 126 bits (316), Expect = 9e-28
Identities = 68/188 (36%), Positives = 101/188 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC S +A VFD + ++V++W +I S F +A ++M GV P+ +T
Sbjct: 375 RCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYTS 434

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L CS A+E GR IH + V+ G+ D VGN L+++Y+ CG DAR+V D M RD
Sbjct: 435 ILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRD 494

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+VA+ +IGGY+ H GKEAL + E + + +T + L AC S + R+IH
Sbjct: 495 IVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINMLNACAN-SGSLEWAREIH 553

Query: 24 AEIVNKGF 1
+ GF
Sbjct: 554 TLVRKGGF 561



Score = 116 bits (290), Expect = 1e-24
Identities = 60/165 (36%), Positives = 91/165 (55%)
Frame = -1

Query: 561 CASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCT 382
C S +A VFD + R++V +N +I ++A +++ EG+ P +T
Sbjct: 477 CGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKVTYINM 536

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
L C+ G++E R IH K G D +VGNAL+S YAKCG F DA V ++M R+V
Sbjct: 537 LNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKMTKRNV 596

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
++W +IGG ++HG G++AL M +E V + +T S L AC
Sbjct: 597 ISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSAC 641



Score = 111 bits (277), Expect = 3e-23
Identities = 69/191 (36%), Positives = 99/191 (51%), Gaps = 4/191 (2%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPV--RNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITL 391
+C S EA V+ L R V +WN ++ + EKA + QM G+ P T+
Sbjct: 70 QCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTI 129

Query: 390 CCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMAN 211
L C GA+E GR IH +A++ G+ D V N +L++YAKCG +AR+V D+M
Sbjct: 130 MSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEK 189

Query: 210 RDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNI-- 37
+ VV+WT IGGY++ G + A +M E V N IT S L A SSP
Sbjct: 190 KSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITYISVLNA---FSSPAALKWG 246

Query: 36 RQIHAEIVNKG 4
+ +H+ I+N G
Sbjct: 247 KAVHSRILNAG 257



Score = 59.7 bits (143), Expect = 1e-07
Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 7/142 (4%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C SF +A VF+ + RNV++WN +I + A E+M +EGV P +T
Sbjct: 577 KCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVS 636

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAV------GNALLSLYAKCGLFLDARKVLD 223
L CS G +E GR + D+A+ ++ L + G +A ++
Sbjct: 637 LLSACSHAGLLEEGRRYFC-----SMSQDFAIIPTIEHYGCMVDLLGRAGQLDEAEALIK 691

Query: 222 EMA-NRDVVAWTTLIGGYSEHG 160
M + W L+G HG
Sbjct: 692 TMPFQANTRIWGALLGACRIHG 713



Score = 58.9 bits (141), Expect = 2e-07
Identities = 37/151 (24%), Positives = 76/151 (50%), Gaps = 2/151 (1%)
Frame = -1

Query: 450 AAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLS 271
A ++ + +G +S LK C + + GR +H ++ D NAL++
Sbjct: 7 AVDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALIN 66

Query: 270 LYAKCGLFLDARKVLDEMA--NRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANS 97
+Y +CG +AR+V +++ R V +W ++ GY ++G+ ++AL L +M ++ +
Sbjct: 67 MYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDR 126

Query: 96 ITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
T+ S L +C + + + R+IH + + G
Sbjct: 127 TTIMSFLSSCKSPGA-LEWGREIHFQAMQAG 156


>tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1
Length = 868

Score = 134 bits (337), Expect = 3e-30
Identities = 63/166 (37%), Positives = 93/166 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF +P RNVV+WN++I + K + M EG P +T+
Sbjct: 442 KCGDLSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVIT 501

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L+ C + +ERG+ +H AVK G++ D V +L+ +Y+KCG +AR V D+M+NRD
Sbjct: 502 ILEACGALAGLERGKLVHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRD 561

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
VAW ++ GY +HG G EA+ M E+VS N ITL + + AC
Sbjct: 562 TVAWNAMLAGYGQHGDGLEAVDLFKRMLKERVSPNEITLTAVISAC 607



Score = 122 bits (306), Expect = 1e-26
Identities = 68/193 (35%), Positives = 99/193 (51%), Gaps = 5/193 (2%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF + RNVV+W +I A +A EQM G+ P+++T
Sbjct: 204 KCGEISVACEVFHKMTERNVVSWTAIIQANAQHRKLNEAFELYEQMLQAGISPNAVTFVS 263

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ A+ RGR IH + G++ D V NAL+++Y KC +AR++ D M+ RD
Sbjct: 264 LLNSCNTPEALNRGRRIHSHISERGLETDMIVANALITMYCKCNSVQEAREIFDRMSKRD 323

Query: 204 VVAWTTLIGGYSEHGFG-----KEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVN 40
V++W+ +I GY++ G+ E L M E V N +T S LRAC T +
Sbjct: 324 VISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNKVTFMSILRAC-TAHGALEQ 382

Query: 39 IRQIHAEIVNKGF 1
RQIHAE+ GF
Sbjct: 383 GRQIHAELSKVGF 395



Score = 103 bits (257), Expect = 7e-21
Identities = 63/223 (28%), Positives = 108/223 (48%), Gaps = 36/223 (16%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAA-----HCIEQMALEGVLPSS 400
+C S EA +FD + R+V++W+ +I S + +K + +E+M EGV P+
Sbjct: 305 KCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNK 364

Query: 399 ITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDE 220
+T L+ C+ GA+E+GR IH K G + D ++ A+ ++YAKCG +A +V +
Sbjct: 365 VTFMSILRACTAHGALEQGRQIHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVFSK 424

Query: 219 MANRDVVAWTT-------------------------------LIGGYSEHGFGKEALMCL 133
MAN++VVAWT+ +I GY+++G + L
Sbjct: 425 MANKNVVAWTSFLSMYIKCGDLSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELL 484

Query: 132 GEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
M E + +T+ + L AC ++ + + +HAE V G
Sbjct: 485 SSMKAEGFQPDRVTVITILEACGALAG-LERGKLVHAEAVKLG 526



Score = 102 bits (254), Expect = 1e-20
Identities = 59/177 (33%), Positives = 94/177 (53%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VF + +R+VVTW+ +I A + KA E+M + P+ IT LK C+
Sbjct: 113 VFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIEPNRITFLSILKACNNYSI 172

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+E+GR IH G++ D AV AL+++Y+KCG A +V +M R+VV+WT +I
Sbjct: 173 LEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVACEVFHKMTERNVVSWTAIIQA 232

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
++H EA +M +S N++T S L +C T + + R+IH+ I +G
Sbjct: 233 NAQHRKLNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPEA-LNRGRRIHSHISERG 288



Score = 65.1 bits (157), Expect = 3e-09
Identities = 40/138 (28%), Positives = 69/138 (50%)
Frame = -1

Query: 417 GVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDA 238
G+L +S T C ++ C++ E G+ +H + + G++ D +GN+L++ Y+K A
Sbjct: 51 GLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLGNSLINFYSKFEDVASA 110

Query: 237 RKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITV 58
+V M RDVV W+++I Y+ + +A M + N IT S L+AC
Sbjct: 111 EQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIEPNRITFLSILKACNNY 170

Query: 57 SSPIVNIRQIHAEIVNKG 4
S + R+IH + G
Sbjct: 171 SI-LEKGRKIHTIVKAMG 187



Score = 56.6 bits (135), Expect = 9e-07
Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C EA VFD + R+ V WN ++ +A ++M E V P+ ITL
Sbjct: 543 KCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGDGLEAVDLFKRMLKERVSPNEITLTA 602

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVG------NALLSLYAKCGLFLDARKVLD 223
+ CSR G ++ GR I R ++E D+ + ++ L + G +A + +
Sbjct: 603 VISACSRAGLVQEGREI-FRMMQE----DFKMTPRKQHYGCMVDLLGRAGRLQEAEEFIQ 657

Query: 222 EM-ANRDVVAWTTLIGGYSEH 163
M D+ W L+G H
Sbjct: 658 SMPCEPDISVWHALLGACKSH 678


>tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192787 PE=4 SV=1
Length = 804

Score = 134 bits (337), Expect = 3e-30
Identities = 75/189 (39%), Positives = 107/189 (56%), Gaps = 2/189 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C +F +A VF+ L R+V+ WN +I DS E+A +M EGV P T
Sbjct: 277 KCGAFKDAREVFECLSYRDVIAWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDRATYTT 336

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+R G + RG+ IH RA K+G+ D GNAL+++Y+K G DAR+V D M RD
Sbjct: 337 VLSACARPGGLARGKEIHARAAKDGLVSDVRFGNALINMYSKAGSMKDARQVFDRMPKRD 396

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNI--RQ 31
VV+WTTL+G Y++ E+ +M + V AN IT L+AC S+P+ ++
Sbjct: 397 VVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMCVLKAC---SNPVALKWGKE 453

Query: 30 IHAEIVNKG 4
IHAE+V G
Sbjct: 454 IHAEVVKAG 462



Score = 133 bits (334), Expect = 8e-30
Identities = 72/187 (38%), Positives = 107/187 (57%)
Frame = -1

Query: 561 CASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCT 382
C S EA +FD ++VV+WN++I+ ++A + M E + P T
Sbjct: 76 CGSVNEARQLFDKFSNKSVVSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSI 135

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
L CS + GR IH+R ++ G+ D VGNAL+S+YAKCG DAR+V D MA+RD
Sbjct: 136 LSACSSPAVLNWGREIHVRVMEAGLANDTTVGNALISMYAKCGSVRDARRVFDAMASRDE 195

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHA 22
V+WTTL G Y+E G+G+E+L M E+V + IT + L AC ++++ + +QIHA
Sbjct: 196 VSWTTLTGAYAESGYGEESLKTYHAMLQERVRPSRITYMNVLSACGSLAA-LEKGKQIHA 254

Query: 21 EIVNKGF 1
IV +
Sbjct: 255 HIVESEY 261



Score = 119 bits (298), Expect = 1e-25
Identities = 67/166 (40%), Positives = 93/166 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+ S +A VFD +P R+VV+W L+ D + ++ +QM +GV + IT C
Sbjct: 378 KAGSMKDARQVFDRMPKRDVVSWTTLLGRYADCDQVVESFTTFKQMLQQGVKANKITYMC 437

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK CS A++ G+ IH VK G+ D AV NAL+S+Y KCG DA +V + M+ RD
Sbjct: 438 VLKACSNPVALKWGKEIHAEVVKAGLLADLAVTNALMSMYFKCGSVEDAIRVFEGMSMRD 497

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
VV W TLIGG ++G G EAL M E + N+ T + L AC
Sbjct: 498 VVTWNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFVNVLSAC 543



Score = 107 bits (266), Expect = 6e-22
Identities = 63/187 (33%), Positives = 93/187 (49%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S +A VFD + R+ V+W L A +S + E++ M E V PS IT
Sbjct: 176 KCGSVRDARRVFDAMASRDEVSWTTLTGAYAESGYGEESLKTYHAMLQERVRPSRITYMN 235

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C + A+E+G+ IH V+ D V AL +Y KCG F DAR+V + ++ RD
Sbjct: 236 VLSACGSLAALEKGKQIHAHIVESEYHSDVRVSTALTKMYMKCGAFKDAREVFECLSYRD 295

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
V+AW T+I G+ + G +EA M E V+ + T + L AC + ++IH
Sbjct: 296 VIAWNTMIRGFVDSGQLEEAHGTFHRMLEEGVAPDRATYTTVLSACARPGG-LARGKEIH 354

Query: 24 AEIVNKG 4
A G
Sbjct: 355 ARAAKDG 361



Score = 74.7 bits (182), Expect = 3e-12
Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 2/128 (1%)
Frame = -1

Query: 381 LKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDV 202
L+ C + + G+ +H ++ G+ + + N LL LYA CG +AR++ D+ +N+ V
Sbjct: 35 LQSCVKAKDLAVGKQVHEHILRCGVKPNVYITNTLLKLYAHCGSVNEARQLFDKFSNKSV 94

Query: 201 VAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNI--RQI 28
V+W +I GY+ G +EA M E++ + T S L AC SSP V R+I
Sbjct: 95 VSWNVMISGYAHRGLAQEAFNLFTLMQQERLEPDKFTFVSILSAC---SSPAVLNWGREI 151

Query: 27 HAEIVNKG 4
H ++ G
Sbjct: 152 HVRVMEAG 159



Score = 44.7 bits (104), Expect = 0.004
Identities = 25/75 (33%), Positives = 37/75 (49%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S +A VF+ + +R+VVTWN LI + +A E M EG+ P++ T
Sbjct: 479 KCGSVEDAIRVFEGMSMRDVVTWNTLIGGLGQNGRGLEALQRYEVMKSEGMRPNAATFVN 538

Query: 384 TLKCCSRIGAIERGR 340
L C +E GR
Sbjct: 539 VLSACRVCNLVEEGR 553


>tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211228 PE=4 SV=1
Length = 868

Score = 134 bits (337), Expect = 3e-30
Identities = 63/166 (37%), Positives = 93/166 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF +P RNVV+WN++I + K + M EG P +T+
Sbjct: 442 KCGDLSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVIT 501

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L+ C + +ERG+ +H AVK G++ D V +L+ +Y+KCG +AR V D+M+NRD
Sbjct: 502 ILEACGALAGLERGKLVHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRD 561

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
VAW ++ GY +HG G EA+ M E+VS N ITL + + AC
Sbjct: 562 TVAWNAMLAGYGQHGDGLEAVDLFKRMLKERVSPNEITLTAVISAC 607



Score = 122 bits (306), Expect = 1e-26
Identities = 68/193 (35%), Positives = 99/193 (51%), Gaps = 5/193 (2%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VF + RNVV+W +I A +A EQM G+ P+++T
Sbjct: 204 KCGEISVACEVFHKMTERNVVSWTAIIQANAQHRKLNEAFELYEQMLQAGISPNAVTFVS 263

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ A+ RGR IH + G++ D V NAL+++Y KC +AR++ D M+ RD
Sbjct: 264 LLNSCNTPEALNRGRRIHSHISERGLETDMIVANALITMYCKCNSVQEAREIFDRMSKRD 323

Query: 204 VVAWTTLIGGYSEHGFG-----KEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVN 40
V++W+ +I GY++ G+ E L M E V N +T S LRAC T +
Sbjct: 324 VISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNKVTFMSILRAC-TAHGALEQ 382

Query: 39 IRQIHAEIVNKGF 1
RQIHAE+ GF
Sbjct: 383 GRQIHAELSKVGF 395



Score = 103 bits (257), Expect = 7e-21
Identities = 63/223 (28%), Positives = 108/223 (48%), Gaps = 36/223 (16%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAA-----HCIEQMALEGVLPSS 400
+C S EA +FD + R+V++W+ +I S + +K + +E+M EGV P+
Sbjct: 305 KCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNK 364

Query: 399 ITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDE 220
+T L+ C+ GA+E+GR IH K G + D ++ A+ ++YAKCG +A +V +
Sbjct: 365 VTFMSILRACTAHGALEQGRQIHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVFSK 424

Query: 219 MANRDVVAWTT-------------------------------LIGGYSEHGFGKEALMCL 133
MAN++VVAWT+ +I GY+++G + L
Sbjct: 425 MANKNVVAWTSFLSMYIKCGDLSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELL 484

Query: 132 GEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
M E + +T+ + L AC ++ + + +HAE V G
Sbjct: 485 SSMKAEGFQPDRVTVITILEACGALAG-LERGKLVHAEAVKLG 526



Score = 102 bits (254), Expect = 1e-20
Identities = 59/177 (33%), Positives = 94/177 (53%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VF + +R+VVTW+ +I A + KA E+M + P+ IT LK C+
Sbjct: 113 VFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIEPNRITFLSILKACNNYSI 172

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+E+GR IH G++ D AV AL+++Y+KCG A +V +M R+VV+WT +I
Sbjct: 173 LEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVACEVFHKMTERNVVSWTAIIQA 232

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
++H EA +M +S N++T S L +C T + + R+IH+ I +G
Sbjct: 233 NAQHRKLNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPEA-LNRGRRIHSHISERG 288



Score = 65.1 bits (157), Expect = 3e-09
Identities = 40/138 (28%), Positives = 69/138 (50%)
Frame = -1

Query: 417 GVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDA 238
G+L +S T C ++ C++ E G+ +H + + G++ D +GN+L++ Y+K A
Sbjct: 51 GLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLGNSLINFYSKFEDVASA 110

Query: 237 RKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITV 58
+V M RDVV W+++I Y+ + +A M + N IT S L+AC
Sbjct: 111 EQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIEPNRITFLSILKACNNY 170

Query: 57 SSPIVNIRQIHAEIVNKG 4
S + R+IH + G
Sbjct: 171 SI-LEKGRKIHTIVKAMG 187



Score = 56.6 bits (135), Expect = 9e-07
Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C EA VFD + R+ V WN ++ +A ++M E V P+ ITL
Sbjct: 543 KCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGDGLEAVDLFKRMLKERVSPNEITLTA 602

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVG------NALLSLYAKCGLFLDARKVLD 223
+ CSR G ++ GR I R ++E D+ + ++ L + G +A + +
Sbjct: 603 VISACSRAGLVQEGREI-FRMMQE----DFKMTPRKQHYGCMVDLLGRAGRLQEAEEFIQ 657

Query: 222 EM-ANRDVVAWTTLIGGYSEH 163
M D+ W L+G H
Sbjct: 658 SMPCEPDISVWHALLGACKSH 678


>tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133419 PE=4 SV=1
Length = 505

Score = 132 bits (333), Expect = 1e-29
Identities = 72/187 (38%), Positives = 106/187 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S V+A VF LP RNVV+W +I+A + E+A C +M EG++
Sbjct: 295 KCGSVVDALKVFQKLPQRNVVSWTSVISAYAQAGEPERALECYAKMLNEGMVADKRAYTT 354

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ +G IE+G+ +H V+ GI D N L+ +Y KCG DA ++ +M RD
Sbjct: 355 ILNVCAMLGDIEKGKAVHGHIVQSGIATDIITENGLIDMYVKCGRLKDAYRLFQDMNVRD 414

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
VV+WTTLI G+ +H +EAL +M LE V N++T L+AC + S +V+ ++IH
Sbjct: 415 VVSWTTLIEGWVQHRQYQEALDTFNDMQLEGVMPNTVTFLGVLKACAGMGS-LVDGKRIH 473

Query: 24 AEIVNKG 4
A IV G
Sbjct: 474 ARIVEAG 480



Score = 110 bits (274), Expect = 7e-23
Identities = 62/188 (32%), Positives = 96/188 (51%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S V+A VFD + R++ T+ +++T + E A EQM E V IT
Sbjct: 96 KCGSLVDARQVFDRMVERDMFTYTMMLTGYAKLGYPEDAYKMYEQMQKERVPVDRITFTT 155

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L CS + ++E+G +H V+ GI D +GN L+ +YAKCG A +V EM NRD
Sbjct: 156 ILNVCSTLRSLEKGMKVHQDMVRGGIRPDIILGNTLIDMYAKCGNLKQAHRVFKEMDNRD 215

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+V W ++GG + +G+ EA M E + +T S L AC ++ + +H
Sbjct: 216 IVTWNIMVGGAARNGYFDEAFEFFKAMLDEGQKPDKVTYISILNACTSLEQGTL----LH 271

Query: 24 AEIVNKGF 1
+ I+ GF
Sbjct: 272 SVIMKAGF 279



Score = 103 bits (256), Expect = 9e-21
Identities = 56/187 (29%), Positives = 99/187 (52%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + +A VF + R++VTWNI++ + + ++A + M EG P +T
Sbjct: 197 KCGNLKQAHRVFKEMDNRDIVTWNIMVGGAARNGYFDEAFEFFKAMLDEGQKPDKVTYIS 256

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C+ ++E+G +H +K G + D VG AL+++++KCG +DA KV ++ R+
Sbjct: 257 ILNACT---SLEQGTLLHSVIMKAGFELDVRVGTALVNMFSKCGSVVDALKVFQKLPQRN 313

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
VV+WT++I Y++ G + AL C +M E + A+ + L C + I + +H
Sbjct: 314 VVSWTSVISAYAQAGEPERALECYAKMLNEGMVADKRAYTTILNVCAMLGD-IEKGKAVH 372

Query: 24 AEIVNKG 4
IV G
Sbjct: 373 GHIVQSG 379



Score = 86.3 bits (212), Expect = 1e-15
Identities = 46/151 (30%), Positives = 80/151 (52%)
Frame = -1

Query: 456 EKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNAL 277
+ + H +EQ +E PSS C L+ C+ + + G+ +H K V NAL
Sbjct: 34 KNSLHILEQRGIE---PSSYAYVCLLRRCTHMKDLAEGKYVHAHMAKSDFVPTTFVLNAL 90

Query: 276 LSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANS 97
+++Y KCG +DAR+V D M RD+ +T ++ GY++ G+ ++A +M E+V +
Sbjct: 91 VNMYMKCGSLVDARQVFDRMVERDMFTYTMMLTGYAKLGYPEDAYKMYEQMQKERVPVDR 150

Query: 96 ITLDSSLRACITVSSPIVNIRQIHAEIVNKG 4
IT + L C T+ S + ++H ++V G
Sbjct: 151 ITFTTILNVCSTLRS-LEKGMKVHQDMVRGG 180



Score = 71.6 bits (174), Expect = 3e-11
Identities = 34/103 (33%), Positives = 58/103 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C +A+ +F + VR+VV+W LI ++A M LEGV+P+++T
Sbjct: 396 KCGRLKDAYRLFQDMNVRDVVSWTTLIEGWVQHRQYQEALDTFNDMQLEGVMPNTVTFLG 455

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKC 256
LK C+ +G++ G+ IH R V+ G+ + + +AL +YAKC
Sbjct: 456 VLKACAGMGSLVDGKRIHARIVEAGLAENAHIRHALADMYAKC 498


>tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031846 PE=4 SV=1
Length = 654

Score = 129 bits (324), Expect = 1e-28
Identities = 66/188 (35%), Positives = 103/188 (54%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S +A F+T +N +TW+ +IT S +KA M L G+ PS T
Sbjct: 256 KCGSLDDALQTFETSSDKNSITWSAMITGXAQSGDSDKALKLFSSMHLSGIRPSEFTFVG 315

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
+ CS +GA G+ +H +K G + V AL+ +YAKC +DARK D + D
Sbjct: 316 VINACSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARKGFDYLQEPD 375

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+V WT++IGGY ++G ++AL G M +E + N +T+ S L+AC ++++ + +QIH
Sbjct: 376 IVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMASVLKACSSLAA-LEQGKQIH 434

Query: 24 AEIVNKGF 1
A V GF
Sbjct: 435 ARTVKYGF 442



Score = 124 bits (310), Expect = 5e-27
Identities = 63/166 (37%), Positives = 94/166 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C+S V+A FD L ++V W +I + +E A +M +EG+LP+ +T+
Sbjct: 357 KCSSIVDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMAS 416

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK CS + A+E+G+ IH R VK G + +G+AL ++YAKCG D V M RD
Sbjct: 417 VLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDGTLVFRRMPARD 476

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
V++W +I G S++G GKEAL EM LE + +T + L AC
Sbjct: 477 VISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDYVTFVNILSAC 522



Score = 89.4 bits (220), Expect = 1e-16
Identities = 51/182 (28%), Positives = 87/182 (47%)
Frame = -1

Query: 546 EAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCS 367
EA VFDT+P RN V+W +I+ + +A M E + L +
Sbjct: 161 EARKVFDTMPERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGENEFVFTSVLSALT 220

Query: 366 RIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTT 187
+ G+ IH AVK G+ +VGNAL+++YAKCG DA + + ++++ + W+
Sbjct: 221 LPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGSLDDALQTFETSSDKNSITWSA 280

Query: 186 LIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNK 7
+I G ++ G +AL MHL + + T + AC + + +Q+H ++
Sbjct: 281 MITGXAQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINACSDLGAAWEG-KQVHDYLLKL 339

Query: 6 GF 1
GF
Sbjct: 340 GF 341



Score = 89.0 bits (219), Expect = 2e-16
Identities = 59/190 (31%), Positives = 91/190 (47%), Gaps = 3/190 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIE---QMALEGVLPSSIT 394
+C EA +VF+ + ++VV+WN +I + ++H +E +M E P++ T
Sbjct: 52 KCQRLREAKFVFERIQNKDVVSWNCIINGYSQHG-PSGSSHVMELFQRMRAENTAPNAHT 110

Query: 393 LCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMA 214
S + GR H A+K D VG++L+++Y K GL +ARKV D M
Sbjct: 111 FAGVFTAASTLVDAAGGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVFDTMP 170

Query: 213 NRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIR 34
R+ V+W T+I GY+ EAL M E+ N S L A +T+ + N +
Sbjct: 171 ERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGENEFVFTSVLSA-LTLPELVNNGK 229

Query: 33 QIHAEIVNKG 4
QIH V G
Sbjct: 230 QIHCIAVKNG 239



Score = 62.0 bits (149), Expect = 2e-08
Identities = 37/120 (30%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
Frame = -1

Query: 411 LPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARK 232
LPS+ + L + ++++G+ +H + +K Y + N+L++LYAKC +A+
Sbjct: 3 LPSNRSFFTALLQYTHNRSLQKGKALHAQIIKSSSSCVY-IANSLVNLYAKCQRLREAKF 61

Query: 231 VLDEMANRDVVAWTTLIGGYSEHG-FGKEALMCLGE-MHLEKVSANSITLDSSLRACITV 58
V + + N+DVV+W +I GYS+HG G +M L + M E + N+ T A T+
Sbjct: 62 VFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTAASTL 121



Score = 55.8 bits (133), Expect = 2e-06
Identities = 24/74 (32%), Positives = 40/74 (54%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + VF +P R+V++WN +I+ + + ++A E+M LEG P +T
Sbjct: 458 KCGCLKDGTLVFRRMPARDVISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDYVTFVN 517

Query: 384 TLKCCSRIGAIERG 343
L CS +G +ERG
Sbjct: 518 ILSACSHMGLVERG 531


>tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015531001
PE=4 SV=1
Length = 703

Score = 129 bits (323), Expect = 1e-28
Identities = 66/188 (35%), Positives = 103/188 (54%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C S +A F+T +N +TW+ +IT S +KA M L G+ PS T
Sbjct: 256 KCGSLDDALQTFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSMHLSGIRPSEFTFVG 315

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
+ CS +GA G+ +H +K G + V AL+ +YAKC +DARK D + D
Sbjct: 316 VINACSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARKGFDYLQEPD 375

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+V WT++IGGY ++G ++AL G M +E + N +T+ S L+AC ++++ + +QIH
Sbjct: 376 IVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMASVLKACSSLAA-LEQGKQIH 434

Query: 24 AEIVNKGF 1
A V GF
Sbjct: 435 ARTVKYGF 442



Score = 124 bits (310), Expect = 5e-27
Identities = 63/166 (37%), Positives = 94/166 (56%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C+S V+A FD L ++V W +I + +E A +M +EG+LP+ +T+
Sbjct: 357 KCSSIVDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEMEGILPNELTMAS 416

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK CS + A+E+G+ IH R VK G + +G+AL ++YAKCG D V M RD
Sbjct: 417 VLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDGTLVFRRMPARD 476

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
V++W +I G S++G GKEAL EM LE + +T + L AC
Sbjct: 477 VISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDYVTFVNILSAC 522



Score = 92.4 bits (228), Expect = 2e-17
Identities = 52/182 (28%), Positives = 88/182 (48%)
Frame = -1

Query: 546 EAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCS 367
EA VFDT+P RN V+W +I+ + +A M E + L +
Sbjct: 161 EARKVFDTMPERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGENEFVFTSVLSALT 220

Query: 366 RIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTT 187
+ G+ IH AVK G+ +VGNAL+++YAKCG DA + + ++++ + W+
Sbjct: 221 LPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGSLDDALQTFETSSDKNSITWSA 280

Query: 186 LIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNK 7
+I GY++ G +AL MHL + + T + AC + + +Q+H ++
Sbjct: 281 MITGYAQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINACSDLGAAWEG-KQVHDYLLKL 339

Query: 6 GF 1
GF
Sbjct: 340 GF 341



Score = 89.0 bits (219), Expect = 2e-16
Identities = 59/190 (31%), Positives = 91/190 (47%), Gaps = 3/190 (1%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIE---QMALEGVLPSSIT 394
+C EA +VF+ + ++VV+WN +I + ++H +E +M E P++ T
Sbjct: 52 KCQRLREAKFVFERIQNKDVVSWNCIINGYSQHG-PSGSSHVMELFQRMRAENTAPNAHT 110

Query: 393 LCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMA 214
S + GR H A+K D VG++L+++Y K GL +ARKV D M
Sbjct: 111 FAGVFTAASTLVDAAGGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVFDTMP 170

Query: 213 NRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIR 34
R+ V+W T+I GY+ EAL M E+ N S L A +T+ + N +
Sbjct: 171 ERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGENEFVFTSVLSA-LTLPELVNNGK 229

Query: 33 QIHAEIVNKG 4
QIH V G
Sbjct: 230 QIHCIAVKNG 239



Score = 62.0 bits (149), Expect = 2e-08
Identities = 37/120 (30%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
Frame = -1

Query: 411 LPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARK 232
LPS+ + L + ++++G+ +H + +K Y + N+L++LYAKC +A+
Sbjct: 3 LPSNRSFFTALLQYTHNRSLQKGKALHAQIIKSSSSCVY-IANSLVNLYAKCQRLREAKF 61

Query: 231 VLDEMANRDVVAWTTLIGGYSEHG-FGKEALMCLGE-MHLEKVSANSITLDSSLRACITV 58
V + + N+DVV+W +I GYS+HG G +M L + M E + N+ T A T+
Sbjct: 62 VFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTAASTL 121



Score = 56.2 bits (134), Expect = 1e-06
Identities = 37/153 (24%), Positives = 67/153 (43%), Gaps = 8/153 (5%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + VF +P R+V++WN +I+ + + ++A E+M LEG P +T
Sbjct: 458 KCGCLKDGTLVFRRMPARDVISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDYVTFVN 517

Query: 384 TLKCCSRIGAIERGRTIHIRAVKE-GIDGDYAVGNALLSLYAKCGLFLDARKVLDEMA-N 211
L CS +G +ERG E G+D ++ + ++ G +A + + +
Sbjct: 518 ILSACSHMGLVERGWGYFRMMFDEFGMDPRVEHYACMVDILSRAGKLKEAIEFTESATID 577

Query: 210 RDVVAWTTLIG------GYSEHGFGKEALMCLG 130
+ W ++G Y + E LM LG
Sbjct: 578 HGMCLWRIILGACRNYRNYELGAYAGEKLMELG 610


>tr|Q60DN6|Q60DN6_ORYSJ Os03g0644200 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0038E17.22 PE=2 SV=1
Length = 616

Score = 128 bits (322), Expect = 2e-28
Identities = 58/184 (31%), Positives = 106/184 (57%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A +FD + R+V++W +ITA +A +M EG P+ T+C
Sbjct: 227 QCGDVASASAIFDKMAYRDVISWTTMITAYVQHGHGGQALRMFSEMVSEGFRPNEFTVCS 286

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+ A+ G+ +H +K+ D +G+AL+++YA+CG DA+ V D M R+
Sbjct: 287 VLKACAEEKAVRFGKQLHCAVLKKMYKNDIHIGSALVTMYARCGEVFDAQAVFDMMPRRN 346

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+ WT++I GY++ G G++A++ +M + +V N++T+ L AC ++ SP + +++H
Sbjct: 347 TITWTSMISGYAQSGHGEKAILLFRKMKMRRVFVNNLTIVGLLSACGSLQSPYLG-KELH 405

Query: 24 AEIV 13
A+I+
Sbjct: 406 AQII 409



Score = 112 bits (281), Expect = 1e-23
Identities = 60/186 (32%), Positives = 100/186 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC +A VFD +P RN +TW +I+ S EKA +M + V +++T+
Sbjct: 328 RCGEVFDAQAVFDMMPRRNTITWTSMISGYAQSGHGEKAILLFRKMKMRRVFVNNLTIVG 387

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C + + G+ +H + +K ++ + +G+ L+ Y KCG + A ++L+ M +RD
Sbjct: 388 LLSACGSLQSPYLGKELHAQIIKNSMEENLQIGSTLVWFYCKCGEYTYAARILEAMPDRD 447

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
++WT LI GY+ G EAL L +M + V N+ T S+L+AC + + + R+IH
Sbjct: 448 AISWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSSALKACAKLEA-LQYGRKIH 506

Query: 24 AEIVNK 7
VNK
Sbjct: 507 G-FVNK 511



Score = 96.3 bits (238), Expect = 1e-18
Identities = 57/176 (32%), Positives = 86/176 (48%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD +P R+VV+W ++ + M GV +S+T C LK C
Sbjct: 137 VFDEMPERSVVSWTAMMNVYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGERCD 196

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+ G+ +H VK G + V +A+ YA+CG A + D+MA RDV++WTT+I
Sbjct: 197 AKLGQQVHCCIVKGGWS-NVIVDSAIAHFYAQCGDVASASAIFDKMAYRDVISWTTMITA 255

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNK 7
Y +HG G +AL EM E N T+ S L+AC + +Q+H ++ K
Sbjct: 256 YVQHGHGGQALRMFSEMVSEGFRPNEFTVCSVLKACAEEKAVRFG-KQLHCAVLKK 310



Score = 92.0 bits (227), Expect = 2e-17
Identities = 46/166 (27%), Positives = 87/166 (52%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + A + + +P R+ ++W LI+ + + +A ++ M +GV P++ T
Sbjct: 429 KCGEYTYAARILEAMPDRDAISWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSS 488

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+++ A++ GR IH K + VG++L+ +Y +CG +AR V D M +
Sbjct: 489 ALKACAKLEALQYGRKIHGFVNKTQDFSNVFVGSSLIDMYMRCGKVDEARSVFDAMPEHN 548

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
+V W +I G++++G +EAL + M E + L + L +C
Sbjct: 549 LVTWKVIITGFAQNGLCEEALKYMYLMQQEGHEVDDFVLSTVLTSC 594



Score = 59.7 bits (143), Expect = 1e-07
Identities = 44/140 (31%), Positives = 67/140 (47%)
Frame = -1

Query: 420 EGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLD 241
E LP++ L +L+ C G + R +H AV+ V N L+S YA+ D
Sbjct: 77 ESSLPNAEALASSLRDC---GGADGVRRVHAVAVRSLDSLGTFVANNLISAYARFDEVSD 133

Query: 240 ARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACIT 61
AR+V DEM R VV+WT ++ Y + G E + +M V NS+T L++C
Sbjct: 134 AREVFDEMPERSVVSWTAMMNVYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGE 193

Query: 60 VSSPIVNIRQIHAEIVNKGF 1
+ +Q+H IV G+
Sbjct: 194 RCDAKLG-QQVHCCIVKGGW 212


>tr|B6SWY6|B6SWY6_MAIZE Pentatricopeptide repeat protein PPR1106-17
OS=Zea mays PE=2 SV=1
Length = 618

Score = 128 bits (322), Expect = 2e-28
Identities = 64/184 (34%), Positives = 107/184 (58%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A VFD + R+V++W +ITA +KA M EG P+ T+C
Sbjct: 236 QCGDVAAASTVFDRMASRDVISWTTMITAYVQHGHSDKALQMFPTMVSEGFRPNEFTVCS 295

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+ A+ G+ +H VK+ D VG+AL+++YA+CG DA+ V D+M R+
Sbjct: 296 ALKACAEEKALRFGKQLHGAIVKKLYKYDIHVGSALVTMYARCGEVFDAQTVFDKMPRRN 355

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+ WT++I GY++ G G+EA++ +M + +V N +T+ S L AC ++ S I + +++H
Sbjct: 356 TITWTSMISGYAQSGCGEEAVLLFRKMKMRRVFVNHLTIVSLLSACGSMQS-IYHGKELH 414

Query: 24 AEIV 13
A+I+
Sbjct: 415 AQII 418



Score = 108 bits (271), Expect = 2e-22
Identities = 60/186 (32%), Positives = 100/186 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC +A VFD +P RN +TW +I+ S E+A +M + V + +T+
Sbjct: 337 RCGEVFDAQTVFDKMPRRNTITWTSMISGYAQSGCGEEAVLLFRKMKMRRVFVNHLTIVS 396

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C + +I G+ +H + +K ++ + +G+ L+ Y + G A ++L+ M +RD
Sbjct: 397 LLSACGSMQSIYHGKELHAQIIKNCMEENLQIGSTLVWFYNRRGEHTYATRILEAMPDRD 456

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
VAWT +I GY+ G EAL L EM + V N+ T S+L+AC + + + + R+IH
Sbjct: 457 AVAWTAMISGYNNLGHNVEALKSLDEMLWDGVVPNTYTYSSALKACARLEA-LQDGRRIH 515

Query: 24 AEIVNK 7
+VNK
Sbjct: 516 G-VVNK 520



Score = 98.2 bits (243), Expect = 3e-19
Identities = 58/176 (32%), Positives = 87/176 (49%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD +P R++V+W ++ + A + M + GV +S+T C LK C
Sbjct: 146 VFDEMPERSIVSWTAMMNGYQKLGCHGEVARLLMDMLIAGVQGNSLTFVCLLKSCGERCD 205

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
G+ +H VK G + V +A+ YA+CG A V D MA+RDV++WTT+I
Sbjct: 206 ARLGQQVHCCVVKGGWS-NVIVDSAITHFYAQCGDVAAASTVFDRMASRDVISWTTMITA 264

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNK 7
Y +HG +AL M E N T+ S+L+AC + +Q+H IV K
Sbjct: 265 YVQHGHSDKALQMFPTMVSEGFRPNEFTVCSALKACAEEKALRFG-KQLHGAIVKK 319



Score = 90.5 bits (223), Expect = 6e-17
Identities = 45/156 (28%), Positives = 84/156 (53%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
+ + +P R+ V W +I+ + + +A +++M +GV+P++ T LK C+R+ A
Sbjct: 448 ILEAMPDRDAVAWTAMISGYNNLGHNVEALKSLDEMLWDGVVPNTYTYSSALKACARLEA 507

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
++ GR IH K + VG +L+ +Y +CG +AR+V D M ++V W +I G
Sbjct: 508 LQDGRRIHGVVNKTQAFSNVFVGCSLIDMYMRCGKVDEARRVFDAMPEHNLVTWKVMITG 567

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
++++G +EAL + M E + L + L +C
Sbjct: 568 FTQNGRSEEALKYMFLMQQEGYVVDEFVLSTVLSSC 603



Score = 60.8 bits (146), Expect = 5e-08
Identities = 41/137 (29%), Positives = 68/137 (49%)
Frame = -1

Query: 411 LPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARK 232
LP + + L+ C R + R + +R++ G G + V N L+S Y + +ARK
Sbjct: 89 LPDAEAVAFWLRFCRRELDVRRAHAVALRSL--GSLGVF-VSNNLISAYVRFDEVANARK 145

Query: 231 VLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSS 52
V DEM R +V+WT ++ GY + G E L +M + V NS+T L++C
Sbjct: 146 VFDEMPERSIVSWTAMMNGYQKLGCHGEVARLLMDMLIAGVQGNSLTFVCLLKSCGERCD 205

Query: 51 PIVNIRQIHAEIVNKGF 1
+ +Q+H +V G+
Sbjct: 206 ARLG-QQVHCCVVKGGW 221



Score = 44.3 bits (103), Expect = 0.005
Identities = 23/65 (35%), Positives = 31/65 (47%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC EA VFD +P N+VTW ++IT T + E+A + M EG + L
Sbjct: 539 RCGKVDEARRVFDAMPEHNLVTWKVMITGFTQNGRSEEALKYMFLMQQEGYVVDEFVLST 598

Query: 384 TLKCC 370
L C
Sbjct: 599 VLSSC 603


>tr|A3AKS8|A3AKS8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011400 PE=4 SV=1
Length = 583

Score = 128 bits (322), Expect = 2e-28
Identities = 58/184 (31%), Positives = 106/184 (57%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C A +FD + R+V++W +ITA +A +M EG P+ T+C
Sbjct: 194 QCGDVASASAIFDKMAYRDVISWTTMITAYVQHGHGGQALRMFSEMVSEGFRPNEFTVCS 253

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+ A+ G+ +H +K+ D +G+AL+++YA+CG DA+ V D M R+
Sbjct: 254 VLKACAEEKAVRFGKQLHCAVLKKMYKNDIHIGSALVTMYARCGEVFDAQAVFDMMPRRN 313

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
+ WT++I GY++ G G++A++ +M + +V N++T+ L AC ++ SP + +++H
Sbjct: 314 TITWTSMISGYAQSGHGEKAILLFRKMKMRRVFVNNLTIVGLLSACGSLQSPYLG-KELH 372

Query: 24 AEIV 13
A+I+
Sbjct: 373 AQII 376



Score = 112 bits (281), Expect = 1e-23
Identities = 60/186 (32%), Positives = 100/186 (53%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
RC +A VFD +P RN +TW +I+ S EKA +M + V +++T+
Sbjct: 295 RCGEVFDAQAVFDMMPRRNTITWTSMISGYAQSGHGEKAILLFRKMKMRRVFVNNLTIVG 354

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
L C + + G+ +H + +K ++ + +G+ L+ Y KCG + A ++L+ M +RD
Sbjct: 355 LLSACGSLQSPYLGKELHAQIIKNSMEENLQIGSTLVWFYCKCGEYTYAARILEAMPDRD 414

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIH 25
++WT LI GY+ G EAL L +M + V N+ T S+L+AC + + + R+IH
Sbjct: 415 AISWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSSALKACAKLEA-LQYGRKIH 473

Query: 24 AEIVNK 7
VNK
Sbjct: 474 G-FVNK 478



Score = 96.3 bits (238), Expect = 1e-18
Identities = 57/176 (32%), Positives = 86/176 (48%)
Frame = -1

Query: 534 VFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCCTLKCCSRIGA 355
VFD +P R+VV+W ++ + M GV +S+T C LK C
Sbjct: 104 VFDEMPERSVVSWTAMMNVYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGERCD 163

Query: 354 IERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRDVVAWTTLIGG 175
+ G+ +H VK G + V +A+ YA+CG A + D+MA RDV++WTT+I
Sbjct: 164 AKLGQQVHCCIVKGGWS-NVIVDSAIAHFYAQCGDVASASAIFDKMAYRDVISWTTMITA 222

Query: 174 YSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACITVSSPIVNIRQIHAEIVNK 7
Y +HG G +AL EM E N T+ S L+AC + +Q+H ++ K
Sbjct: 223 YVQHGHGGQALRMFSEMVSEGFRPNEFTVCSVLKACAEEKAVRFG-KQLHCAVLKK 277



Score = 92.0 bits (227), Expect = 2e-17
Identities = 46/166 (27%), Positives = 87/166 (52%)
Frame = -1

Query: 564 RCASFVEAWWVFDTLPVRNVVTWNILITACTDSEFDEKAAHCIEQMALEGVLPSSITLCC 385
+C + A + + +P R+ ++W LI+ + + +A ++ M +GV P++ T
Sbjct: 396 KCGEYTYAARILEAMPDRDAISWTALISGYNNLGHNVEALKSLDDMLWDGVKPNTYTYSS 455

Query: 384 TLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLDARKVLDEMANRD 205
LK C+++ A++ GR IH K + VG++L+ +Y +CG +AR V D M +
Sbjct: 456 ALKACAKLEALQYGRKIHGFVNKTQDFSNVFVGSSLIDMYMRCGKVDEARSVFDAMPEHN 515

Query: 204 VVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRAC 67
+V W +I G++++G +EAL + M E + L + L +C
Sbjct: 516 LVTWKVIITGFAQNGLCEEALKYMYLMQQEGHEVDDFVLSTVLTSC 561



Score = 59.7 bits (143), Expect = 1e-07
Identities = 44/140 (31%), Positives = 67/140 (47%)
Frame = -1

Query: 420 EGVLPSSITLCCTLKCCSRIGAIERGRTIHIRAVKEGIDGDYAVGNALLSLYAKCGLFLD 241
E LP++ L +L+ C G + R +H AV+ V N L+S YA+ D
Sbjct: 44 ESSLPNAEALASSLRDC---GGADGVRRVHAVAVRSLDSLGTFVANNLISAYARFDEVSD 100

Query: 240 ARKVLDEMANRDVVAWTTLIGGYSEHGFGKEALMCLGEMHLEKVSANSITLDSSLRACIT 61
AR+V DEM R VV+WT ++ Y + G E + +M V NS+T L++C
Sbjct: 101 AREVFDEMPERSVVSWTAMMNVYLKLGHYGEVVRLFFDMVGSGVQGNSLTFVCLLKSCGE 160

Query: 60 VSSPIVNIRQIHAEIVNKGF 1
+ +Q+H IV G+
Sbjct: 161 RCDAKLG-QQVHCCIVKGGW 179