BP920475
Clone id YMU001_000137_E06
Library
Length 400
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000137_E06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGAGTCTACTAGAACATGCCCATAATTAACAGCGAGGGTTAGGGTTAGTGCTCTGCTAG
CGATGGTTAACTCCTTAACCTCGCCGCACCTGCCCGAGTAGGGCAGGATGTTCCCAGCGT
CTTTTCCCTTGCGCCCTCCTCTCCAATTGCATGCGTCACCCACTGGCAATGCATGGGATG
CAGCCAATGCGCTACCGCACCGTACCTCTCTCTTGCTTCCAAACGTTCCATCCGCACATT
TGGCCCCAATCGGGCCCCCTCAGGTCTTGTCATCGTCGGACCCTCCCATCACAAAGGTTC
TACCACCTGAGTTAGCAGAAAAGCTTGTTCAAGCTCTCACTGCTCGGCATCAGCTCTTAT
CAAGTAAATCCCCTGCTTGTGATGGTGACCACTCTCACCG
■■Homology search results ■■ -
sp_hit_id Q91V98
Definition sp|Q91V98|CD248_MOUSE Endosialin OS=Mus musculus
Align length 120
Score (bit) 39.7
E-value 0.005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920475|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_E06.
(400 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q91V98|CD248_MOUSE Endosialin OS=Mus musculus GN=Cd248 PE=2 SV=1 40 0.005
sp|Q8BI84|MIA3_MOUSE Melanoma inhibitory activity protein 3 OS=M... 34 0.26
sp|Q0P5M0|PRR19_BOVIN Proline-rich protein 19 OS=Bos taurus GN=P... 33 0.34
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 O... 33 0.34
sp|Q99988|GDF15_HUMAN Growth/differentiation factor 15 OS=Homo s... 33 0.58
sp|A2AQH4|BCORL_MOUSE BCoR-like protein 1 OS=Mus musculus GN=Bco... 33 0.58
sp|Q2T9I5|RBM26_XENLA RNA-binding protein 26 OS=Xenopus laevis G... 32 0.75
sp|Q9NVV2|YS055_HUMAN Putative uncharacterized protein FLJ10490 ... 32 0.98
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A... 32 0.98
sp|Q92766|RREB1_HUMAN RAS-responsive element-binding protein 1 O... 32 0.98
sp|Q5R4H1|T22D1_PONAB TSC22 domain family protein 1 OS=Pongo abe... 32 1.3
sp|Q6FNU4|SEC31_CANGA Protein transport protein SEC31 OS=Candida... 32 1.3
sp|Q3YZ12|HCAB_SHISS 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|Q83QJ8|HCAB_SHIFL 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|Q0T1X8|HCAB_SHIF8 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|Q31XU9|HCAB_SHIBS 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|A8A347|HCAB_ECOHS 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|Q8XA72|HCAB_ECO57 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|A7ZPY4|HCAB_ECO24 3-phenylpropionate-dihydrodiol/cinnamic aci... 31 1.7
sp|Q03211|PEXLP_TOBAC Pistil-specific extensin-like protein OS=N... 31 1.7
sp|Q6VUC0|AP2E_HUMAN Transcription factor AP-2 epsilon OS=Homo s... 31 1.7
sp|O35817|AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegi... 31 1.7
sp|Q15714|T22D1_HUMAN TSC22 domain family protein 1 OS=Homo sapi... 31 2.2
sp|Q6C443|OXR1_YARLI Oxidation resistance protein 1 OS=Yarrowia ... 31 2.2
sp|Q03414|MEF2A_XENLA Myocyte-specific enhancer factor 2A homolo... 31 2.2
sp|Q63187|ELOA1_RAT Transcription elongation factor B polypeptid... 31 2.2
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 O... 31 2.2
sp|Q5H9F3|BCORL_HUMAN BCoR-like protein 1 OS=Homo sapiens GN=BCO... 31 2.2
sp|Q50630|PG44_MYCTU Uncharacterized PE-PGRS family protein PE_P... 30 2.8
sp|Q5AHB1|PAN1_CANAL Actin cytoskeleton-regulatory complex prote... 30 2.9

>sp|Q91V98|CD248_MOUSE Endosialin OS=Mus musculus GN=Cd248 PE=2 SV=1
Length = 765

Score = 39.7 bits (91), Expect = 0.005
Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 12/120 (10%)
Frame = +3

Query: 75 LTSPHLPE*GRMFPASFPLR-PPLQLHASPTGNAWDAANALPHRTSLLL----------- 218
L H P+ G + +FP P +LH PT +A P+ +S++
Sbjct: 398 LAPTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPYHSSVVSATRPMVISATR 457

Query: 219 PNVPSAHLAPIGPPQVLSSSDPPITKVLPPELAEKLVQALTARHQLLSSKSPACDGDHSH 398
P +PSAH V+S++ PP++ V PP +A A+ + HQ+ K+ D H
Sbjct: 458 PTLPSAHKT-----SVISATRPPLSPVHPPAMAPATPPAVFSEHQIPKIKANYPDLPFGH 512


>sp|Q8BI84|MIA3_MOUSE Melanoma inhibitory activity protein 3 OS=Mus
musculus GN=Mia3 PE=1 SV=2
Length = 1930

Score = 33.9 bits (76), Expect = 0.26
Identities = 27/90 (30%), Positives = 37/90 (41%)
Frame = +3

Query: 75 LTSPHLPE*GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIG 254
L +P PE G P R P Q + P N D + P P + + +
Sbjct: 1021 LVTPPPPEEGWARPGEE--RQPPQQDSLPQENTGDLSVQPPEE-----PELSDQPVTSVQ 1073

Query: 255 PPQVLSSSDPPITKVLPPELAEKLVQALTA 344
PP+ SD P+T V PPE E Q +T+
Sbjct: 1074 PPEEPELSDQPVTSVQPPEEPELSDQPVTS 1103


>sp|Q0P5M0|PRR19_BOVIN Proline-rich protein 19 OS=Bos taurus
GN=PRR19 PE=2 SV=1
Length = 363

Score = 33.5 bits (75), Expect = 0.34
Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
Frame = +3

Query: 114 PASFPLRPPLQLHASPTGNAWDAANALPHRTSL-LLPNVPSAHLAPIGPPQVLSSSDPPI 290
P P PPL SP+G AW A S+ L+ P IGPPQ+L P+
Sbjct: 264 PPKGPWPPPLSSLPSPSGAAWGPPTAFDLLKSIWLVATPPPPRPWGIGPPQLLPQPPSPL 323


>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus
musculus GN=Notch1 PE=1 SV=2
Length = 2531

Score = 33.5 bits (75), Expect = 0.34
Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 9/116 (7%)
Frame = +3

Query: 78 TSPHLPE*GRMFPASFPLRPP-LQLHASPTGNAWDAANALPHRTSLLLPNVPS-AHLAPI 251
T PHL + ++ P + PL+P LQ + P + AAN H L PS A + P+
Sbjct: 2364 TQPHLVQTQQVQPQNLPLQPQNLQPPSQPHLSVSSAANG--HLGRSFLSGEPSQADVQPL 2421

Query: 252 GPPQV-LSSSDPPITKVLPPELAEKLV------QALTARHQLLSSKSPACDGDHSH 398
GP + + + P ++ LP L +V Q LT Q S SP D SH
Sbjct: 2422 GPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPPSQHSYSSSPV-DNTPSH 2476


>sp|Q99988|GDF15_HUMAN Growth/differentiation factor 15 OS=Homo
sapiens GN=GDF15 PE=1 SV=2
Length = 308

Score = 32.7 bits (73), Expect = 0.58
Identities = 27/83 (32%), Positives = 35/83 (42%), Gaps = 7/83 (8%)
Frame = +3

Query: 90 LPE*GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIGPP--- 260
LPE R+ A F L P +WD L + SL P P+ HL PP
Sbjct: 114 LPEASRLHRALFRLSPT-------ASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQS 166

Query: 261 -QVL---SSSDPPITKVLPPELA 317
Q+L SS+ P + L P+ A
Sbjct: 167 DQLLAESSSARPQLELHLRPQAA 189


>sp|A2AQH4|BCORL_MOUSE BCoR-like protein 1 OS=Mus musculus GN=Bcorl1
PE=2 SV=1
Length = 1781

Score = 32.7 bits (73), Expect = 0.58
Identities = 35/113 (30%), Positives = 46/113 (40%), Gaps = 14/113 (12%)
Frame = +3

Query: 45 VSALLAMVNSLTSPHLPE*GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPN 224
VSA + + +++PH P S P PL + S A A P +L+L +
Sbjct: 271 VSASVLVPVPVSAPHSVP----VPLSAPAPTPLTVSVSAPPLALIQAPVPPSAPTLVLAS 326

Query: 225 VPSAHLAPI---------GPPQV-----LSSSDPPITKVLPPELAEKLVQALT 341
VP+ LAP+ PP V SS PP T L P A V A T
Sbjct: 327 VPTPVLAPMPASTPPAAPAPPSVPMPTPTPSSGPPSTPTLIPAFAPTPVPAPT 379


>sp|Q2T9I5|RBM26_XENLA RNA-binding protein 26 OS=Xenopus laevis
GN=rbm26 PE=2 SV=2
Length = 1059

Score = 32.3 bits (72), Expect = 0.75
Identities = 22/62 (35%), Positives = 26/62 (41%)
Frame = +3

Query: 123 FPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIGPPQVLSSSDPPITKVL 302
FP PP+ P G LP SLL P + P+ PP L S PP+T
Sbjct: 370 FPAPPPVLEGPPPPG--------LPPPPSLLTPPPVNLQPPPVPPPGPLPPSLPPVTGPP 421

Query: 303 PP 308
PP
Sbjct: 422 PP 423


>sp|Q9NVV2|YS055_HUMAN Putative uncharacterized protein FLJ10490
OS=Homo sapiens PE=2 SV=2
Length = 129

Score = 32.0 bits (71), Expect = 0.98
Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
Frame = +3

Query: 114 PASFPLRPPLQLH-----ASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIG 254
P S PLRPP +LH A+PT A P RT L++ + P P G
Sbjct: 32 PHSAPLRPPRELHAAPPPATPTQTVVRPA-GFPRRTRLMVRSAPPTQRPPTG 82


>sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase
C17A2.12 OS=Schizosaccharomyces pombe GN=SPAC17A2.12
PE=2 SV=1
Length = 897

Score = 32.0 bits (71), Expect = 0.98
Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 10/75 (13%)
Frame = +3

Query: 120 SFPLRPPLQLHAS----------PTGNAWDAANALPHRTSLLLPNVPSAHLAPIGPPQVL 269
+FP RPP +L ++ P+ ++ + +++PH TS + ++PS VL
Sbjct: 100 NFPFRPPTRLTSTPSNSSSLPSIPSSSSTPSISSIPHTTSSVSNDIPS----------VL 149

Query: 270 SSSDPPITKVLPPEL 314
SSD PI P L
Sbjct: 150 GSSDHPIDLDNPEHL 164


>sp|Q92766|RREB1_HUMAN RAS-responsive element-binding protein 1
OS=Homo sapiens GN=RREB1 PE=1 SV=3
Length = 1687

Score = 32.0 bits (71), Expect = 0.98
Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 5/99 (5%)
Frame = +3

Query: 114 PASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIGPPQVLSSSDPPIT 293
P + PL+ P+QL +A ++ L ++LL +A L P+ P L PP+T
Sbjct: 1003 PPAQPLQGPVQLAVPIYSSALVSSPPLVGSSALLSG---TALLRPLRPKPPLLLPKPPVT 1059

Query: 294 KVLPPELA-EKLVQALTARHQLLSSK----SPACDGDHS 395
+ LPP + +++ ++++ LL +K PA G ++
Sbjct: 1060 EELPPLASIAQIISSVSSAPTLLKTKVADPGPASTGSNT 1098


tr_hit_id B6LLN6
Definition tr|B6LLN6|B6LLN6_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 50
Score (bit) 38.9
E-value 0.13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920475|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_E06.
(400 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6LLN6|B6LLN6_BRAFL Putative uncharacterized protein OS=Branc... 39 0.13
tr|A4FZC4|A4FZC4_METM5 Amidohydrolase OS=Methanococcus maripalud... 39 0.13
tr|Q291D0|Q291D0_DROPS GA11866 OS=Drosophila pseudoobscura pseud... 37 0.37
tr|B6NSB9|B6NSB9_BRAFL Putative uncharacterized protein (Fragmen... 37 0.48
tr|Q47LM4|Q47LM4_THEFY Putative uncharacterized protein OS=Therm... 37 0.49
tr|Q949D2|Q949D2_ORYSA Putative ethylene responsive element bind... 37 0.49
tr|Q7XAD6|Q7XAD6_ORYSJ Ap25 OS=Oryza sativa subsp. japonica PE=2... 37 0.49
tr|Q6H6I3|Q6H6I3_ORYSJ Os02g0655200 protein OS=Oryza sativa subs... 37 0.49
tr|A2X7X8|A2X7X8_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.49
tr|A9UUX9|A9UUX9_MONBE Predicted protein OS=Monosiga brevicollis... 37 0.49
tr|A9G0Y5|A9G0Y5_SORC5 Protein kinase OS=Sorangium cellulosum (s... 37 0.64
tr|A7T5E9|A7T5E9_NEMVE Predicted protein (Fragment) OS=Nematoste... 37 0.64
tr|A7S589|A7S589_NEMVE Predicted protein (Fragment) OS=Nematoste... 36 0.83
tr|B7PVX6|B7PVX6_IXOSC Putative uncharacterized protein (Fragmen... 36 0.83
tr|A7E4F0|A7E4F0_SCLS1 Putative uncharacterized protein OS=Scler... 35 1.4
tr|Q2RX10|Q2RX10_RHORT Putative uncharacterized protein OS=Rhodo... 35 1.4
tr|Q6M093|Q6M093_METMP Atrazine chlorohydrolase related protein ... 35 1.8
tr|A9A6S1|A9A6S1_METM6 Amidohydrolase OS=Methanococcus maripalud... 35 1.8
tr|A6VJ13|A6VJ13_METM7 Amidohydrolase OS=Methanococcus maripalud... 35 1.8
tr|Q5XJE0|Q5XJE0_DANRE Zgc:103407 OS=Danio rerio GN=smad9 PE=2 SV=1 35 2.4
tr|B6TE26|B6TE26_MAIZE Putative uncharacterized protein OS=Zea m... 35 2.4
tr|A5PJT4|A5PJT4_BOVIN PNPLA1 protein OS=Bos taurus GN=PNPLA1 PE... 35 2.4
tr|Q6A3P7|Q6A3P7_DANRE Mothers against decapentaplegic homolog 8... 34 3.2
tr|Q4A4A0|Q4A4A0_STRFR Putative uncharacterized protein OS=Strep... 34 3.2
tr|Q9FM17|Q9FM17_ARATH Similarity to nuclear protein ZAP OS=Arab... 34 3.2
tr|Q56XD6|Q56XD6_ARATH ZAP-like protein OS=Arabidopsis thaliana ... 34 3.2
tr|B4QRL7|B4QRL7_DROSI GD13891 OS=Drosophila simulans GN=GD13891... 34 3.2
tr|A8IYP9|A8IYP9_CHLRE Predicted protein OS=Chlamydomonas reinha... 34 4.1
tr|Q4SA07|Q4SA07_TETNG Chromosome 12 SCAF14692, whole genome sho... 34 4.1
tr|Q4A2U2|Q4A2U2_9PHYC Putative membrane protein OS=Emiliania hu... 34 4.1

>tr|B6LLN6|B6LLN6_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_71959 PE=4 SV=1
Length = 1363

Score = 38.9 bits (89), Expect = 0.13
Identities = 19/50 (38%), Positives = 26/50 (52%)
Frame = -1

Query: 274 DDKT*GGPIGAKCADGTFGSKREVRCGSALAASHALPVGDACNWRGGRKG 125
+D G PI +CA GTFG++ ++ C S L GD C+ GR G
Sbjct: 372 NDALIGAPIRQQCARGTFGNQCQLTCESCLFGGVCNTEGDGCDCPAGRAG 421


>tr|A4FZC4|A4FZC4_METM5 Amidohydrolase OS=Methanococcus maripaludis
(strain C5 / ATCC BAA-1333) GN=MmarC5_1260 PE=4 SV=1
Length = 427

Score = 38.9 bits (89), Expect = 0.13
Identities = 20/58 (34%), Positives = 28/58 (48%)
Frame = -2

Query: 270 TRPEGARLGPNVRMERLEARERYGAVAHWLHPMHCQWVTHAIGEEGAREKTLGTSCPT 97
TR E L + M +E E+ G + LH HC W+T ++ A+ KT CPT
Sbjct: 222 TRYEVVELENKIGMRPVEYLEKIGVLNEKLHAAHCVWITKDEAKKLAKNKTKVIHCPT 279


>tr|Q291D0|Q291D0_DROPS GA11866 OS=Drosophila pseudoobscura
pseudoobscura GN=GA11866 PE=4 SV=2
Length = 3366

Score = 37.4 bits (85), Expect = 0.37
Identities = 23/63 (36%), Positives = 28/63 (44%)
Frame = +3

Query: 153 ASPTGNAWDAANALPHRTSLLLPNVPSAHLAPIGPPQVLSSSDPPITKVLPPELAEKLVQ 332
A P+ N A LP + P P+A AP PP + P T LP AE VQ
Sbjct: 2920 AVPSSNLGPAPRTLPALIPISNPPPPTAPPAPTAPPAPTAPPAPTTTPALPVSHAEDTVQ 2979

Query: 333 ALT 341
+LT
Sbjct: 2980 SLT 2982


>tr|B6NSB9|B6NSB9_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_235412 PE=4 SV=1
Length = 1354

Score = 37.0 bits (84), Expect = 0.48
Identities = 17/42 (40%), Positives = 23/42 (54%)
Frame = -1

Query: 250 IGAKCADGTFGSKREVRCGSALAASHALPVGDACNWRGGRKG 125
+G KCA GTFG++ ++ C S L GD C+ GR G
Sbjct: 387 MGLKCARGTFGNQCQLTCESCLFGGVCNTEGDGCDCPAGRAG 428


>tr|Q47LM4|Q47LM4_THEFY Putative uncharacterized protein
OS=Thermobifida fusca (strain YX) GN=Tfu_2615 PE=4 SV=1
Length = 716

Score = 37.0 bits (84), Expect = 0.49
Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 2/81 (2%)
Frame = +3

Query: 75 LTSPHLPE*GRMFPASFPLRPPLQLHASPTGNAWDAANALPH--RTSLLLPNVPSAHLAP 248
+T P P+ G+ P P PP Q ASP G A A P + N PS P
Sbjct: 316 MTGPQPPQ-GQPGPGQPPGPPPRQ--ASPAGPPLPPAGAAPSGPQQGPAAWNAPSGAQPP 372

Query: 249 IGPPQVLSSSDPPITKVLPPE 311
+ PP +++ PP T PP+
Sbjct: 373 LAPPAGQAAASPPPTAPFPPQ 393


>tr|Q949D2|Q949D2_ORYSA Putative ethylene responsive element binding
factor OS=Oryza sativa GN=W700ERIPDM PE=4 SV=1
Length = 345

Score = 37.0 bits (84), Expect = 0.49
Identities = 20/49 (40%), Positives = 26/49 (53%)
Frame = +3

Query: 102 GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAP 248
G + P S P RPPL + PT +AW AA A+ H +LL +A P
Sbjct: 102 GEVSPVSDPRRPPLTISLPPTSHAWAAAEAV-HPAALLQAQAAAAAADP 149


>tr|Q7XAD6|Q7XAD6_ORYSJ Ap25 OS=Oryza sativa subsp. japonica PE=2
SV=1
Length = 345

Score = 37.0 bits (84), Expect = 0.49
Identities = 20/49 (40%), Positives = 26/49 (53%)
Frame = +3

Query: 102 GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAP 248
G + P S P RPPL + PT +AW AA A+ H +LL +A P
Sbjct: 102 GEVSPVSDPRRPPLTISLPPTSHAWAAAEAV-HPAALLQAQAAAAAADP 149


>tr|Q6H6I3|Q6H6I3_ORYSJ Os02g0655200 protein OS=Oryza sativa subsp.
japonica GN=P0519E06.5 PE=4 SV=1
Length = 344

Score = 37.0 bits (84), Expect = 0.49
Identities = 20/49 (40%), Positives = 26/49 (53%)
Frame = +3

Query: 102 GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAP 248
G + P S P RPPL + PT +AW AA A+ H +LL +A P
Sbjct: 102 GEVSPVSDPRRPPLTISLPPTSHAWAAAEAV-HPAALLQAQTAAAAADP 149


>tr|A2X7X8|A2X7X8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08323 PE=4 SV=1
Length = 345

Score = 37.0 bits (84), Expect = 0.49
Identities = 20/49 (40%), Positives = 26/49 (53%)
Frame = +3

Query: 102 GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNVPSAHLAP 248
G + P S P RPPL + PT +AW AA A+ H +LL +A P
Sbjct: 102 GEVSPVSDPRRPPLTISLPPTSHAWAAAEAV-HPAALLQAQAAAAAADP 149


>tr|A9UUX9|A9UUX9_MONBE Predicted protein OS=Monosiga brevicollis
GN=36327 PE=4 SV=1
Length = 486

Score = 37.0 bits (84), Expect = 0.49
Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
Frame = +3

Query: 78 TSPHLPE*GRMFPASFPLRPPLQLHASPTGNAWDAANALPHRTSLLLPNV-PSAHLAPIG 254
T+P LPE GRM P S P R P ++ G+ AA A P + + P P A + I
Sbjct: 93 TAPQLPEPGRMLPTSTPARAPA---SANRGSTSAAAPAPPSVEAKVAPKAKPDASPSAIS 149

Query: 255 PPQVLS 272
PP++ +
Sbjct: 150 PPKMFT 155