BP920488
Clone id YMU001_000137_F09
Library
Length 519
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000137_F09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGAGGAGATGTTTCAAAGGAAGAGGATGTCAATGCAATAATGAAAGCTGCTGTCGACAAG
TGGAGCACAATAGATATTTTGGTGAATAATGCAGGAATCACTAGGGACACTCTAATGATG
AGAATGAAGAAGTCTCAATGACAAGAAGTTCTTGATTTGAATTTAACTGGTGTCTTTATG
TGCACGCAGGCAGCTGCAAAATTGATGATGAAGAAGCGAAAGGGAAGGATCATCAATATC
TCTTCGGTAGTAGGTTTAACAGGAAATGTTGGTCAAGCGAACTACAGTGCTGCGAAGGCA
GGAGTTATTGGCCTCACCAAAACTGTCGCCCGAGAGTATGCATCTCGGAATATCACTGCA
AATGCTATTGTACCTGGCTTCATAGCATCAGACATGACAGCCAAGCTCAGTGCTGACATT
GAAAAGAAGATTCTCGAGACTATATCATTAGGTAGATATGGTACACCAGAAGAGGTTGCT
GGCCTTGTGAAGTTTTTGGCTCTAGATCCAGCTGCTGCA
■■Homology search results ■■ -
sp_hit_id P28643
Definition sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata
Align length 173
Score (bit) 278.0
E-value 1.0e-74
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920488|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_F09.
(519 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase,... 278 1e-74
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 267 2e-71
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 266 3e-71
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 266 3e-71
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 266 6e-71
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 257 2e-68
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase,... 253 4e-67
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase... 216 5e-56
sp|P27582|FABG6_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase... 215 9e-56
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase ... 201 2e-51
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase ... 181 2e-45
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase ... 179 9e-45
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase ... 178 2e-44
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase ... 171 2e-42
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase ... 170 3e-42
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase ... 165 1e-40
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase ... 165 1e-40
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase ... 164 3e-40
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase ... 164 3e-40
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase ... 164 3e-40
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase ... 162 9e-40
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase ... 161 2e-39
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase ... 161 2e-39

>sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase,
chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1
Length = 320

Score = 278 bits (711), Expect = 1e-74
Identities = 139/173 (80%), Positives = 156/173 (90%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKEEDV A++K AVD W T+DILVNNAGITRD L+MRMKKSQ QEV+DLNLTGVF+
Sbjct: 133 GGDVSKEEDVEAMIKTAVDAWGTVDILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFL 192

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAAAK+MMKK+KGRIINI+SVVGL GN GQANYSAAKAGVIG TKTVAREYASRNI
Sbjct: 193 CTQAAAKIMMKKKKGRIINIASVVGLVGNAGQANYSAAKAGVIGFTKTVAREYASRNINV 252

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFI+SDMT+KL DI KKILETI LGRYG PEEVAGLV+FLA++PA++
Sbjct: 253 NAVAPGFISSDMTSKLGDDINKKILETIPLGRYGQPEEVAGLVEFLAINPASS 305


>sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2,
chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1
Length = 328

Score = 267 bits (683), Expect = 2e-71
Identities = 134/173 (77%), Positives = 152/173 (87%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV+A+MK AVD W TID++VNNAGITRDTL++RMKKSQ EV+DLNLTGVF+
Sbjct: 141 GGDVSKEADVDAMMKTAVDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFL 200

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI
Sbjct: 201 CTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINV 260

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTAKL D+EKKIL TI LGRYG PE+VAGLV+FLAL PAA+
Sbjct: 261 NVVCPGFIASDMTAKLGEDMEKKILGTIPLGRYGQPEDVAGLVEFLALSPAAS 313


>sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3,
chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1
Length = 315

Score = 266 bits (681), Expect = 3e-71
Identities = 133/173 (76%), Positives = 151/173 (87%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV A+MK A+D W TID++VNNAGITRDTL++RMKKSQ EV+DLNLTGVF+
Sbjct: 128 GGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFL 187

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI
Sbjct: 188 CTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINV 247

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTAKL D+EKKIL TI LGRYG PE+VAGLV+FLAL PAA+
Sbjct: 248 NVVCPGFIASDMTAKLGEDMEKKILGTIPLGRYGQPEDVAGLVEFLALSPAAS 300


>sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1,
chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1
Length = 320

Score = 266 bits (681), Expect = 3e-71
Identities = 133/173 (76%), Positives = 151/173 (87%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV A+MK A+D W TID++VNNAGITRDTL++RMKKSQ EV+DLNLTGVF+
Sbjct: 133 GGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFL 192

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI
Sbjct: 193 CTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINV 252

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTAKL D+EKKIL TI LGRYG PE+VAGLV+FLAL PAA+
Sbjct: 253 NVVCPGFIASDMTAKLGEDMEKKILGTIPLGRYGQPEDVAGLVEFLALSPAAS 305


>sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5,
chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2
SV=1
Length = 317

Score = 266 bits (679), Expect = 6e-71
Identities = 133/173 (76%), Positives = 152/173 (87%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV+++MK AVDKW TID++VNNAGITRDTL++RMKKSQ EV+DLNLTGVF+
Sbjct: 130 GGDVSKEADVDSMMKTAVDKWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFL 189

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI
Sbjct: 190 CTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINV 249

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTAKL D+EKKIL TI LGRYG PE VAGLV+FLAL PA++
Sbjct: 250 NVVCPGFIASDMTAKLGEDMEKKILGTIPLGRYGQPEYVAGLVEFLALSPASS 302


>sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4
(Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1
Length = 254

Score = 257 bits (657), Expect = 2e-68
Identities = 131/173 (75%), Positives = 150/173 (86%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV+A+MK AVDKW TID++VNNAG DTL++RMKKSQ EV+DLNLTGVF+
Sbjct: 70 GGDVSKEADVDAMMKTAVDKWGTIDVVVNNAG---DTLLIRMKKSQWDEVMDLNLTGVFL 126

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
C+QAA K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI
Sbjct: 127 CSQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINV 186

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTAKL D+EKKIL TI LGRYG PE+VAGLV+FLAL PAA+
Sbjct: 187 NVVCPGFIASDMTAKLGEDMEKKILGTIPLGRYGQPEDVAGLVEFLALSPAAS 239


>sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase,
chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=2
SV=2
Length = 319

Score = 253 bits (646), Expect = 4e-67
Identities = 127/173 (73%), Positives = 148/173 (85%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSK DV+A+MK A+DKW TID++VNNAGITRDTL++RMK+SQ EV+ LNLTGVF+
Sbjct: 132 GGDVSKATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFL 191

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKK++GRIINISSVVGL GN+GQANY+AAK GVI +KT ARE ASRNI
Sbjct: 192 CTQAAVKIMMKKKRGRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINV 251

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
N + PGFIASDMTA+L D+EKKIL TI LGRYG EEVAGLV+FLAL PAA+
Sbjct: 252 NVVCPGFIASDMTAELGEDMEKKILGTIPLGRYGKAEEVAGLVEFLALSPAAS 304


>sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1
OS=Synechocystis sp. (strain PCC 6803) GN=fabG1 PE=3
SV=1
Length = 247

Score = 216 bits (550), Expect = 5e-56
Identities = 108/171 (63%), Positives = 138/171 (80%)
Frame = +1

Query: 7 DVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFMCT 186
+V+ ++V+ ++K +DK+S ID+LVNNAGITRDTL++RMK Q V+DLNLTGVF+CT
Sbjct: 64 NVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCT 123

Query: 187 QAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITANA 366
+A +KLM+K++ GRIINI+SV G+ GN GQANYSAAKAGVIG TKTVA+E ASR +T NA
Sbjct: 124 KAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNA 183

Query: 367 IVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
+ PGFIA+DMT L+A+ IL+ I L RYG PEEVAG ++FLA DPAAA
Sbjct: 184 VAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAA 231


>sp|P27582|FABG6_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase
(Fragments) OS=Brassica napus PE=1 SV=3
Length = 201

Score = 215 bits (548), Expect = 9e-56
Identities = 112/169 (66%), Positives = 132/169 (78%)
Frame = +1

Query: 13 SKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFMCTQA 192
++E DV+A+MK AVD W ID++ NNAGIT V+ LNLTGVF+C+QA
Sbjct: 33 AREADVDAMMKDAVDYWGQIDVIANNAGIT---------------VIALNLTGVFLCSQA 77

Query: 193 AAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITANAIV 372
A K+MMKKRKGRIINI+SVVGL GN+GQANY+AAKAGVIG +KT ARE ASRNI N +
Sbjct: 78 ATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVC 137

Query: 373 PGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
PGFIAS+MTAKL D+EKKIL TI LGRYG PE+VAGLV+FLAL PAA+
Sbjct: 138 PGFIASEMTAKLGEDMEKKILGTIPLGRYGQPEDVAGLVEFLALSPAAS 186


>sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase
OS=Bacillus subtilis GN=fabG PE=3 SV=3
Length = 246

Score = 201 bits (510), Expect = 2e-51
Identities = 100/169 (59%), Positives = 133/169 (78%)
Frame = +1

Query: 7 DVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFMCT 186
DVS EDV ++K + +STIDILVNNAGITRD L+MRMK+ + +V+++NL GVF CT
Sbjct: 62 DVSNPEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCT 121

Query: 187 QAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITANA 366
+A + MMK+R GRIIN+SS+VG++GN GQANY AAKAGVIGLTK+ A+E ASRNIT NA
Sbjct: 122 KAVTRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNA 181

Query: 367 IVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPA 513
I PGFI++DMT KL+ D++ ++L+ I L R+G P +V+ +V FLA + A
Sbjct: 182 IAPGFISTDMTDKLAKDVQDEMLKQIPLARFGEPSDVSSVVTFLASEGA 230


tr_hit_id B5LAU6
Definition tr|B5LAU6|B5LAU6_CAPAN Putative 3-oxoacyl-(Acyl-carrier protein) reductase OS=Capsicum annuum
Align length 173
Score (bit) 283.0
E-value 3.0e-75
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920488|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_F09.
(519 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5LAU6|B5LAU6_CAPAN Putative 3-oxoacyl-(Acyl-carrier protein)... 283 3e-75
tr|Q7XMI8|Q7XMI8_ORYSJ OSJNBb0006N15.11 protein OS=Oryza sativa ... 283 4e-75
tr|B6THT6|B6THT6_MAIZE 3-oxoacyl-reductase OS=Zea mays PE=2 SV=1 283 4e-75
tr|B4FTC8|B4FTC8_MAIZE Putative uncharacterized protein OS=Zea m... 283 4e-75
tr|A3AT06|A3AT06_ORYSJ Putative uncharacterized protein OS=Oryza... 283 4e-75
tr|B6T8A3|B6T8A3_MAIZE 3-oxoacyl-reductase OS=Zea mays PE=2 SV=1 281 1e-74
tr|A7QBQ9|A7QBQ9_VITVI Chromosome chr1 scaffold_75, whole genome... 281 2e-74
tr|A7PHD0|A7PHD0_VITVI Chromosome chr17 scaffold_16, whole genom... 280 3e-74
tr|A9SRU2|A9SRU2_PHYPA Predicted protein OS=Physcomitrella paten... 279 7e-74
tr|A9RWX6|A9RWX6_PHYPA Predicted protein OS=Physcomitrella paten... 277 3e-73
tr|B6T8T5|B6T8T5_MAIZE 3-oxoacyl-reductase OS=Zea mays PE=2 SV=1 273 4e-72
tr|Q0E119|Q0E119_ORYSJ Os02g0503500 protein OS=Oryza sativa subs... 257 3e-67
tr|B8AIB8|B8AIB8_ORYSI Putative uncharacterized protein OS=Oryza... 257 3e-67
tr|B7FAC8|B7FAC8_ORYSJ cDNA, clone: J100063K09, full insert sequ... 257 3e-67
tr|B4G1H6|B4G1H6_MAIZE Putative uncharacterized protein OS=Zea m... 257 3e-67
tr|Q0JDU3|Q0JDU3_ORYSJ Os04g0376300 protein (Fragment) OS=Oryza ... 253 4e-66
tr|B8AT02|B8AT02_ORYSI Putative uncharacterized protein OS=Oryza... 248 1e-64
tr|A4RQY6|A4RQY6_OSTLU Predicted protein OS=Ostreococcus lucimar... 247 3e-64
tr|Q01GL3|Q01GL3_OSTTA CR051 protein (ISS) OS=Ostreococcus tauri... 245 8e-64
tr|B8BP22|B8BP22_ORYSI Putative uncharacterized protein OS=Oryza... 239 8e-62
tr|Q6K666|Q6K666_ORYSJ Putative 3-oxoacyl-[acyl-carrier protein]... 238 1e-61
tr|Q2QV59|Q2QV59_ORYSJ Os12g0242700 protein OS=Oryza sativa subs... 238 1e-61
tr|Q84X75|Q84X75_CHLRE CR051 protein (Predicted protein) OS=Chla... 232 7e-60
tr|Q5N3T5|Q5N3T5_SYNP6 3-oxoacyl-[acyl-carrier protein] reductas... 227 3e-58
tr|Q31QF3|Q31QF3_SYNE7 3-oxoacyl-[acyl-carrier-protein] reductas... 227 3e-58
tr|B4WIJ2|B4WIJ2_9SYNE 3-oxoacyl-(Acyl-carrier-protein) reductas... 225 9e-58
tr|B1XJQ9|B1XJQ9_SYNP2 3-oxoacyl-(Acyl-carrier-protein) reductas... 224 3e-57
tr|B7K6D5|B7K6D5_SYNP8 3-oxoacyl-(Acyl-carrier-protein) reductas... 223 3e-57
tr|B8HRG1|B8HRG1_9CHRO 3-oxoacyl-(Acyl-carrier-protein) reductas... 222 1e-56
tr|Q8YVT0|Q8YVT0_ANASP 3-oxoacyl-[acyl-carrier protein] reductas... 221 2e-56

>tr|B5LAU6|B5LAU6_CAPAN Putative 3-oxoacyl-(Acyl-carrier protein)
reductase OS=Capsicum annuum PE=2 SV=1
Length = 322

Score = 283 bits (725), Expect = 3e-75
Identities = 140/173 (80%), Positives = 161/173 (93%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKEEDV +++K VD+W TID+L+NNAGITRDTL+MRMKKSQ QEV+DLNLTGVF+
Sbjct: 135 GGDVSKEEDVESMIKTVVDRWGTIDVLINNAGITRDTLLMRMKKSQWQEVIDLNLTGVFL 194

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAAAK+MMKK+KGRIINISSVVGL GN GQANYSAAKAGVIGLTK+VA+EYASRNIT
Sbjct: 195 CTQAAAKIMMKKKKGRIINISSVVGLVGNAGQANYSAAKAGVIGLTKSVAKEYASRNITV 254

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFIASDMTA+LS DIEKKIL++I LGRYG PE+VAGLV+FLAL+PAA+
Sbjct: 255 NAVAPGFIASDMTAQLSEDIEKKILQSIPLGRYGQPEDVAGLVEFLALNPAAS 307


>tr|Q7XMI8|Q7XMI8_ORYSJ OSJNBb0006N15.11 protein OS=Oryza sativa
subsp. japonica GN=OSJNBb0006N15.11 PE=3 SV=2
Length = 318

Score = 283 bits (724), Expect = 4e-75
Identities = 141/172 (81%), Positives = 159/172 (92%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV+++MKAA+DKW TID+LVNNAGITRDTL+MRMKKSQ Q+V+DLNLTGVF+
Sbjct: 131 GGDVSKEADVDSMMKAALDKWGTIDVLVNNAGITRDTLLMRMKKSQWQDVIDLNLTGVFL 190

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKK+KG+IINI+SVVGL GN+GQANYSAAKAGVIGLTKTVAREYASRNI
Sbjct: 191 CTQAATKIMMKKKKGKIINIASVVGLVGNIGQANYSAAKAGVIGLTKTVAREYASRNINV 250

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAA 516
NAI PGFIASDMTA+L D+EKKIL TI LGRYG PEEVAGLV+FLAL+PAA
Sbjct: 251 NAIAPGFIASDMTAELGEDLEKKILSTIPLGRYGKPEEVAGLVEFLALNPAA 302


>tr|B6THT6|B6THT6_MAIZE 3-oxoacyl-reductase OS=Zea mays PE=2 SV=1
Length = 316

Score = 283 bits (724), Expect = 4e-75
Identities = 142/173 (82%), Positives = 159/173 (91%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV ++MKAA+DKW TID+LVNNAGITRDTL+MRMKKSQ Q+V+DLNLTGVF+
Sbjct: 129 GGDVSKEADVESMMKAALDKWGTIDVLVNNAGITRDTLLMRMKKSQWQDVIDLNLTGVFL 188

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKG+IINI+SVVGLTGNVGQANYSAAKAGVIG TKTVAREYASRNI
Sbjct: 189 CTQAATKVMMKKRKGKIINIASVVGLTGNVGQANYSAAKAGVIGFTKTVAREYASRNINV 248

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NAI PGFIASDMTA+L ++EKKIL TI LGRYG PEEVAGLV+FLAL+PAA+
Sbjct: 249 NAIAPGFIASDMTAELGEELEKKILSTIPLGRYGQPEEVAGLVEFLALNPAAS 301


>tr|B4FTC8|B4FTC8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 318

Score = 283 bits (724), Expect = 4e-75
Identities = 142/173 (82%), Positives = 159/173 (91%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV ++MKAA+DKW TID+LVNNAGITRDTL+MRMKKSQ Q+V+DLNLTGVF+
Sbjct: 131 GGDVSKEADVESMMKAALDKWGTIDVLVNNAGITRDTLLMRMKKSQWQDVIDLNLTGVFL 190

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKG+IINI+SVVGLTGNVGQANYSAAKAGVIG TKTVAREYASRNI
Sbjct: 191 CTQAATKVMMKKRKGKIINIASVVGLTGNVGQANYSAAKAGVIGFTKTVAREYASRNINV 250

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NAI PGFIASDMTA+L ++EKKIL TI LGRYG PEEVAGLV+FLAL+PAA+
Sbjct: 251 NAIAPGFIASDMTAELGEELEKKILSTIPLGRYGQPEEVAGLVEFLALNPAAS 303


>tr|A3AT06|A3AT06_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_013928 PE=3 SV=1
Length = 269

Score = 283 bits (724), Expect = 4e-75
Identities = 141/172 (81%), Positives = 159/172 (92%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV+++MKAA+DKW TID+LVNNAGITRDTL+MRMKKSQ Q+V+DLNLTGVF+
Sbjct: 82 GGDVSKEADVDSMMKAALDKWGTIDVLVNNAGITRDTLLMRMKKSQWQDVIDLNLTGVFL 141

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKK+KG+IINI+SVVGL GN+GQANYSAAKAGVIGLTKTVAREYASRNI
Sbjct: 142 CTQAATKIMMKKKKGKIINIASVVGLVGNIGQANYSAAKAGVIGLTKTVAREYASRNINV 201

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAA 516
NAI PGFIASDMTA+L D+EKKIL TI LGRYG PEEVAGLV+FLAL+PAA
Sbjct: 202 NAIAPGFIASDMTAELGEDLEKKILSTIPLGRYGKPEEVAGLVEFLALNPAA 253


>tr|B6T8A3|B6T8A3_MAIZE 3-oxoacyl-reductase OS=Zea mays PE=2 SV=1
Length = 316

Score = 281 bits (719), Expect = 1e-74
Identities = 141/173 (81%), Positives = 158/173 (91%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV ++MKAA+DKW TID+LVNNAGITRD L+MRMKKSQ Q+V+DLNLTGVF+
Sbjct: 129 GGDVSKEADVESMMKAALDKWGTIDVLVNNAGITRDALLMRMKKSQWQDVIDLNLTGVFL 188

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKG+IINI+SVVGLTGNVGQANYSAAKAGVIG TKTVAREYASRNI
Sbjct: 189 CTQAATKVMMKKRKGKIINIASVVGLTGNVGQANYSAAKAGVIGFTKTVAREYASRNINV 248

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NAI PGFIASDMTA+L ++EKKIL TI LGRYG PEEVAGLV+FLAL+PAA+
Sbjct: 249 NAIAPGFIASDMTAELGEELEKKILSTIPLGRYGQPEEVAGLVEFLALNPAAS 301


>tr|A7QBQ9|A7QBQ9_VITVI Chromosome chr1 scaffold_75, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035074001
PE=3 SV=1
Length = 269

Score = 281 bits (718), Expect = 2e-74
Identities = 142/173 (82%), Positives = 156/173 (90%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKE DV A++KAAVD W T+DIL+NNAGITRD L+MRMK Q QEV++LNLTGVF+
Sbjct: 82 GGDVSKEADVEAMIKAAVDAWGTVDILINNAGITRDGLLMRMKTPQWQEVINLNLTGVFL 141

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAAAK+MMKKRKGRIINI+SVVGL GNVGQANYSAAKAGVIGLTKTVA+EYA RNI
Sbjct: 142 CTQAAAKIMMKKRKGRIINIASVVGLVGNVGQANYSAAKAGVIGLTKTVAKEYAGRNINV 201

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFIASDMTAKL DIEKKILETI LGRYG PEEVAGLV+FLALDPAA+
Sbjct: 202 NAVAPGFIASDMTAKLGEDIEKKILETIPLGRYGQPEEVAGLVEFLALDPAAS 254


>tr|A7PHD0|A7PHD0_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017895001
PE=3 SV=1
Length = 269

Score = 280 bits (716), Expect = 3e-74
Identities = 142/173 (82%), Positives = 156/173 (90%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGDVSKEEDV +++K VD W TIDIL+NNAGITRD LMMRMKK Q QEV+DLNLTGVF+
Sbjct: 82 GGDVSKEEDVESMIKTVVDAWGTIDILINNAGITRDGLMMRMKKPQWQEVIDLNLTGVFL 141

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA+K+MMKKRKGRIINISSVVGL GNVGQANYSAAKAGVIGLTK+VA+EYASRNI
Sbjct: 142 CTQAASKIMMKKRKGRIINISSVVGLVGNVGQANYSAAKAGVIGLTKSVAKEYASRNINV 201

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFIASDMTAKL DIEKKIL TI LGRYG PEEVAGLV+FLAL+PAA+
Sbjct: 202 NAVAPGFIASDMTAKLGEDIEKKILGTIPLGRYGQPEEVAGLVEFLALNPAAS 254


>tr|A9SRU2|A9SRU2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_187721 PE=3 SV=1
Length = 328

Score = 279 bits (713), Expect = 7e-74
Identities = 139/173 (80%), Positives = 158/173 (91%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGD+SKE DV+A+ KAA++KW TIDILVNNAGITRDTL+MRMKK Q Q+V+DLNLTGVF+
Sbjct: 141 GGDMSKEADVDALFKAAMNKWGTIDILVNNAGITRDTLLMRMKKEQWQDVIDLNLTGVFL 200

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINISSVVG+TGNVGQANY+AAKAGVIG TK+VAREYA RNIT
Sbjct: 201 CTQAATKVMMKKRKGRIINISSVVGVTGNVGQANYAAAKAGVIGFTKSVAREYAGRNITV 260

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFI+SDMTAKLS DIE++IL+ I LGRYG PE+VAGLVKFLA DPAAA
Sbjct: 261 NAVAPGFISSDMTAKLSKDIEEQILKNIPLGRYGAPEDVAGLVKFLATDPAAA 313


>tr|A9RWX6|A9RWX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_120696 PE=3 SV=1
Length = 295

Score = 277 bits (708), Expect = 3e-73
Identities = 138/173 (79%), Positives = 157/173 (90%)
Frame = +1

Query: 1 GGDVSKEEDVNAIMKAAVDKWSTIDILVNNAGITRDTLMMRMKKSQ*QEVLDLNLTGVFM 180
GGD+SK+EDV+A+ KAA+D W TIDILVNNAGIT+DTL+MRMKK Q Q+V+DLNLTGVF+
Sbjct: 108 GGDMSKQEDVDALFKAAMDTWGTIDILVNNAGITKDTLLMRMKKEQWQDVIDLNLTGVFL 167

Query: 181 CTQAAAKLMMKKRKGRIINISSVVGLTGNVGQANYSAAKAGVIGLTKTVAREYASRNITA 360
CTQAA K+MMKKRKGRIINISSVVG+TGNVGQANYSAAKAGVIG TK+VAREYA RNIT
Sbjct: 168 CTQAATKVMMKKRKGRIINISSVVGVTGNVGQANYSAAKAGVIGFTKSVAREYAGRNITV 227

Query: 361 NAIVPGFIASDMTAKLSADIEKKILETISLGRYGTPEEVAGLVKFLALDPAAA 519
NA+ PGFIASDMTAKL+ +IE IL+TI LG+YG PE+VAGLVKFLA DPAAA
Sbjct: 228 NAVAPGFIASDMTAKLNKEIEAAILKTIPLGKYGQPEDVAGLVKFLATDPAAA 280