BP920504
Clone id YMU001_000137_H03
Library
Length 240
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000137_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCCAAAGTGGAAGCATGTGAGAGGCTCCTACGTCAGTGTAGGTGCAGGAGTAATATCTT
GTCGCAATGAAAAAGCACCAAATGGAGTGGCTGCAAGTGCACATCTTACTGATGGGCTTC
TTCATTTGATTATTGTGAAGGAGTGCTCACGCTTGTCCTATCTTTGGCATCTGATTCAAC
TCACAAGGGAAGGCGCAGATGCTTGGGATTGCTCATTCGTAGAAGAGTACAGGACTCCTC
■■Homology search results ■■ -
sp_hit_id Q8TCT0
Definition sp|Q8TCT0|CERK1_HUMAN Ceramide kinase OS=Homo sapiens
Align length 76
Score (bit) 61.2
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920504|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_H03.
(240 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8TCT0|CERK1_HUMAN Ceramide kinase OS=Homo sapiens GN=CERK PE... 61 2e-09
sp|Q8K4Q7|CERK1_MOUSE Ceramide kinase OS=Mus musculus GN=Cerk PE... 58 1e-08
sp|Q49MI3|CERKL_HUMAN Ceramide kinase-like protein OS=Homo sapie... 42 0.001
sp|Q6B516|SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium disc... 33 0.34
sp|Q86KF9|SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium disc... 33 0.58
sp|Q9LRB0|LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Ara... 31 1.7
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Asp... 29 8.4

>sp|Q8TCT0|CERK1_HUMAN Ceramide kinase OS=Homo sapiens GN=CERK PE=1
SV=1
Length = 537

Score = 61.2 bits (147), Expect = 2e-09
Identities = 29/76 (38%), Positives = 51/76 (67%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
+W+ V G ++++ A +SC ++P G++ +AHL DG LI++++CSR ++L LI+ T
Sbjct: 380 EWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHT 439

Query: 186 REGADAWDCSFVEEYR 233
+ D +D +FVE YR
Sbjct: 440 NQ-QDQFDFTFVEVYR 454


>sp|Q8K4Q7|CERK1_MOUSE Ceramide kinase OS=Mus musculus GN=Cerk PE=2
SV=1
Length = 531

Score = 58.2 bits (139), Expect = 1e-08
Identities = 28/76 (36%), Positives = 49/76 (64%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
+W+ G ++++ A +SC ++P G++ AHL DG LI++++CSR ++L LI+ T
Sbjct: 380 EWQVTCGKFLAINATNMSCACPRSPGGLSPFAHLGDGSSDLILIRKCSRFNFLRFLIRHT 439

Query: 186 REGADAWDCSFVEEYR 233
+ D +D +FVE YR
Sbjct: 440 NQ-EDQFDFTFVEVYR 454


>sp|Q49MI3|CERKL_HUMAN Ceramide kinase-like protein OS=Homo sapiens
GN=CERKL PE=1 SV=1
Length = 558

Score = 41.6 bits (96), Expect = 0.001
Identities = 22/75 (29%), Positives = 40/75 (53%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
+W+ ++G +++V I C AP G+A + L +G + LII + SR ++ HL +
Sbjct: 417 QWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYA 476

Query: 186 REGADAWDCSFVEEY 230
+ ++ FVE Y
Sbjct: 477 -SVKNQFNFPFVETY 490


>sp|Q6B516|SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium
discoideum GN=sgkB PE=2 SV=1
Length = 760

Score = 33.5 bits (75), Expect = 0.34
Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
Frame = +3

Query: 9 WKHVRGSYVSVGAGVISCRNEKAPNGVAA-SAHLTDGLLHLIIVKECSRLS 158
WK + G ++ V A +S A + +++ +AHL+DGL+ LI + S+LS
Sbjct: 642 WKCIEGEFIGVVASTVS---HLASDFISSPNAHLSDGLIDLIFINNRSKLS 689


>sp|Q86KF9|SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium
discoideum GN=sgkA PE=2 SV=2
Length = 624

Score = 32.7 bits (73), Expect = 0.58
Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
Frame = +3

Query: 9 WKHVRGSYVSVGAGVISCRNEKAPNGVAA-SAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
WK + G ++ + A +S A + +A+ +AHL+DGL+ L+++ + S L LT
Sbjct: 507 WKVLEGEFIGIVASTVS---HLASDFIASPTAHLSDGLIDLVVINNNKKFSKAGLLSVLT 563

Query: 186 REGADA 203
A
Sbjct: 564 ESSTGA 569


>sp|Q9LRB0|LCBK1_ARATH Sphingoid long-chain bases kinase 1
OS=Arabidopsis thaliana GN=LCBK1 PE=1 SV=1
Length = 763

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/59 (27%), Positives = 29/59 (49%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
KW +G ++ + +CR ++ VA ++ DG + +++V C RL L I L
Sbjct: 641 KWVSRKGHFLGIMVCNHACRTVQSSQVVAPNSEHDDGTMDMLLVHGCGRLRLLRFFILL 699


>sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1
OS=Aspergillus clavatus GN=atg1 PE=3 SV=1
Length = 928

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
Frame = +3

Query: 24 GSYVSVGAGVISCRNEKAPNGVAASAHLTDGLL--HLIIVKECSRLSYLWHLI 176
G+YV++ + +S N+K +++ H+ GL H++ + +C S HL+
Sbjct: 29 GTYVAIKSVNLSKLNKKLKENLSSEIHILKGLYHPHIVALIDCQETSSHIHLV 81


tr_hit_id A9RG22
Definition tr|A9RG22|A9RG22_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 79
Score (bit) 107.0
E-value 2.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920504|Adiantum capillus-veneris mRNA, clone:
YMU001_000137_H03.
(240 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RG22|A9RG22_PHYPA Predicted protein OS=Physcomitrella paten... 107 2e-22
tr|A9S4S8|A9S4S8_PHYPA Predicted protein OS=Physcomitrella paten... 103 4e-21
tr|A7Q594|A7Q594_VITVI Chromosome undetermined scaffold_52, whol... 101 2e-20
tr|A5ARS4|A5ARS4_VITVI Putative uncharacterized protein OS=Vitis... 101 2e-20
tr|Q949C3|Q949C3_ORYSA Putative uncharacterized protein C875ERIP... 98 2e-19
tr|Q6H6H1|Q6H6H1_ORYSJ Putative ceramide kinase OS=Oryza sativa ... 98 2e-19
tr|Q0DZ01|Q0DZ01_ORYSJ Os02g0656200 protein OS=Oryza sativa subs... 98 2e-19
tr|B8AG39|B8AG39_ORYSI Putative uncharacterized protein OS=Oryza... 98 2e-19
tr|A3A9S0|A3A9S0_ORYSJ Putative uncharacterized protein OS=Oryza... 98 2e-19
tr|B6ST14|B6ST14_MAIZE Diacylglycerol kinase OS=Zea mays PE=2 SV=1 95 2e-18
tr|Q6USK2|Q6USK2_ARATH Ceramide kinase OS=Arabidopsis thaliana G... 91 3e-17
tr|Q9LU45|Q9LU45_ARATH Similarity to unknown protein OS=Arabidop... 74 5e-12
tr|Q5RIP5|Q5RIP5_DANRE Novel protein similar to vertebrate ceram... 69 9e-11
tr|A5WVZ0|A5WVZ0_DANRE Novel protein similar to vertebrate ceram... 69 9e-11
tr|Q6GLV1|Q6GLV1_XENLA MGC84197 protein OS=Xenopus laevis GN=MGC... 68 2e-10
tr|A7RK69|A7RK69_NEMVE Predicted protein (Fragment) OS=Nematoste... 66 7e-10
tr|Q6GMF3|Q6GMF3_XENLA MGC81777 protein OS=Xenopus laevis GN=cer... 65 1e-09
tr|Q4SDW8|Q4SDW8_TETNG Chromosome undetermined SCAF14629, whole ... 65 2e-09
tr|Q5F3H3|Q5F3H3_CHICK Putative uncharacterized protein OS=Gallu... 62 2e-08
tr|B6Q0C3|B6Q0C3_BRAFL Putative uncharacterized protein OS=Branc... 62 2e-08
tr|B6N5Q5|B6N5Q5_BRAFL Putative uncharacterized protein OS=Branc... 62 2e-08
tr|Q6NX59|Q6NX59_HUMAN CERK protein OS=Homo sapiens GN=CERK PE=2... 61 2e-08
tr|B4NI54|B4NI54_DROWI GK14278 OS=Drosophila willistoni GN=GK142... 59 9e-08
tr|Q4SLV3|Q4SLV3_TETNG Chromosome 13 SCAF14555, whole genome sho... 59 2e-07
tr|Q9VNA6|Q9VNA6_DROME CG16708, isoform A OS=Drosophila melanoga... 59 2e-07
tr|Q95S15|Q95S15_DROME HL01538p OS=Drosophila melanogaster GN=CG... 59 2e-07
tr|B4QWA8|B4QWA8_DROSI GD19624 OS=Drosophila simulans GN=GD19624... 59 2e-07
tr|B4PV84|B4PV84_DROYA GE25291 OS=Drosophila yakuba GN=GE25291 P... 59 2e-07
tr|B4I3Z0|B4I3Z0_DROSE GM10643 OS=Drosophila sechellia GN=GM1064... 59 2e-07
tr|B3P2C0|B3P2C0_DROER GG11053 OS=Drosophila erecta GN=GG11053 P... 59 2e-07

>tr|A9RG22|A9RG22_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_158844 PE=4 SV=1
Length = 710

Score = 107 bits (268), Expect = 2e-22
Identities = 50/79 (63%), Positives = 61/79 (77%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
P WK VR + SVGA V+SCRN+KAP GVAA AHL DGLLHLI+++ECSRL YL L++L
Sbjct: 587 PTWKTVRSKFQSVGAAVMSCRNDKAPEGVAAHAHLADGLLHLILIRECSRLGYLRQLLRL 646

Query: 183 TREGADAWDCSFVEEYRTP 239
TR GAD + FVE ++TP
Sbjct: 647 TRRGADPFKFPFVEYHKTP 665


>tr|A9S4S8|A9S4S8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_74586 PE=4 SV=1
Length = 553

Score = 103 bits (257), Expect = 4e-21
Identities = 47/79 (59%), Positives = 59/79 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
P WK + S+GA V+SCRNEKAP GVAA AHL DGLLHLI+++ECSR YL L++L
Sbjct: 431 PTWKTCHAKFQSIGAAVMSCRNEKAPEGVAAHAHLADGLLHLILIRECSRPDYLRQLLRL 490

Query: 183 TREGADAWDCSFVEEYRTP 239
TR GAD ++ FVE ++TP
Sbjct: 491 TRRGADPFNFPFVEHHKTP 509


>tr|A7Q594|A7Q594_VITVI Chromosome undetermined scaffold_52, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00030833001 PE=4 SV=1
Length = 615

Score = 101 bits (252), Expect = 2e-20
Identities = 43/77 (55%), Positives = 57/77 (74%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
+W +GS++SVGA +ISCRNE+AP+G+ A AHL+DG LHLI++K C SYLWHL QL
Sbjct: 495 RWLKSKGSFLSVGAAIISCRNERAPDGLVADAHLSDGFLHLILIKNCPHASYLWHLTQLA 554

Query: 186 REGADAWDCSFVEEYRT 236
R G + + FVE Y+T
Sbjct: 555 RRGGNPLNFEFVEHYKT 571


>tr|A5ARS4|A5ARS4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000107 PE=4 SV=1
Length = 244

Score = 101 bits (252), Expect = 2e-20
Identities = 43/77 (55%), Positives = 57/77 (74%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
+W +GS++SVGA +ISCRNE+AP+G+ A AHL+DG LHLI++K C SYLWHL QL
Sbjct: 124 RWLKSKGSFLSVGAAIISCRNERAPDGLVADAHLSDGFLHLILIKNCPHASYLWHLTQLA 183

Query: 186 REGADAWDCSFVEEYRT 236
R G + + FVE Y+T
Sbjct: 184 RRGGNPLNFEFVEHYKT 200


>tr|Q949C3|Q949C3_ORYSA Putative uncharacterized protein C875ERIPDS
OS=Oryza sativa GN=C875ERIPDS PE=4 SV=1
Length = 586

Score = 98.2 bits (243), Expect = 2e-19
Identities = 41/78 (52%), Positives = 58/78 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
PKW +G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q
Sbjct: 454 PKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLWHLTQF 513

Query: 183 TREGADAWDCSFVEEYRT 236
T++G+D FVE ++T
Sbjct: 514 TKKGSDPLSFKFVEHHKT 531


>tr|Q6H6H1|Q6H6H1_ORYSJ Putative ceramide kinase OS=Oryza sativa
subsp. japonica GN=P0519E06.23 PE=4 SV=1
Length = 700

Score = 98.2 bits (243), Expect = 2e-19
Identities = 41/78 (52%), Positives = 58/78 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
PKW +G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q
Sbjct: 553 PKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLWHLTQF 612

Query: 183 TREGADAWDCSFVEEYRT 236
T++G+D FVE ++T
Sbjct: 613 TKKGSDPLSFKFVEHHKT 630


>tr|Q0DZ01|Q0DZ01_ORYSJ Os02g0656200 protein OS=Oryza sativa subsp.
japonica GN=Os02g0656200 PE=4 SV=1
Length = 653

Score = 98.2 bits (243), Expect = 2e-19
Identities = 41/78 (52%), Positives = 58/78 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
PKW +G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q
Sbjct: 506 PKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLWHLTQF 565

Query: 183 TREGADAWDCSFVEEYRT 236
T++G+D FVE ++T
Sbjct: 566 TKKGSDPLSFKFVEHHKT 583


>tr|B8AG39|B8AG39_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08331 PE=4 SV=1
Length = 627

Score = 98.2 bits (243), Expect = 2e-19
Identities = 41/78 (52%), Positives = 58/78 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
PKW +G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q
Sbjct: 506 PKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLWHLTQF 565

Query: 183 TREGADAWDCSFVEEYRT 236
T++G+D FVE ++T
Sbjct: 566 TKKGSDPLSFKFVEHHKT 583


>tr|A3A9S0|A3A9S0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007542 PE=4 SV=1
Length = 395

Score = 98.2 bits (243), Expect = 2e-19
Identities = 41/78 (52%), Positives = 58/78 (74%)
Frame = +3

Query: 3 PKWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQL 182
PKW +G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q
Sbjct: 248 PKWVWSKGRFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPFYLWHLTQF 307

Query: 183 TREGADAWDCSFVEEYRT 236
T++G+D FVE ++T
Sbjct: 308 TKKGSDPLSFKFVEHHKT 325


>tr|B6ST14|B6ST14_MAIZE Diacylglycerol kinase OS=Zea mays PE=2 SV=1
Length = 606

Score = 94.7 bits (234), Expect = 2e-18
Identities = 40/77 (51%), Positives = 56/77 (72%)
Frame = +3

Query: 6 KWKHVRGSYVSVGAGVISCRNEKAPNGVAASAHLTDGLLHLIIVKECSRLSYLWHLIQLT 185
KW G ++SVGA VISCRNE+AP+G+ A AHL+DG LHL+++++C YLWHL Q T
Sbjct: 486 KWVWSEGHFLSVGAAVISCRNERAPDGLVADAHLSDGFLHLLLIRDCPLPLYLWHLTQFT 545

Query: 186 REGADAWDCSFVEEYRT 236
++G+D FVE ++T
Sbjct: 546 KKGSDPLSFKFVEHHKT 562