BP920511
Clone id YMU001_000138_A02
Library
Length 327
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000138_A02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATATGATGCAGCTCCTTAGTAGCTGTGGAAATCGGCATATGACTCTTAAGCTCAATGGAA
CCATGAAATCTGAAAGTTGAAGTCCATCTATGCTACAAAATAATAAGGCAAGACACTACC
ACCTAGAAAGGTGTGTCAACATAGTAGTGAAAGTTTTATTACAAAATGAAATAAATCCTA
AACTAGGGTCTCAAACCTGGATGCCTAGAGGAAAAAAACCCATAGGAAAAAAGTGTCTCT
AGTATAAATGCATTCAGCTAGTGCACCATAGTCAATATGCTCAAGTCAATGGTCTAGTGC
AATTAGGAGGGATAAGAGAACTCTCTC
■■Homology search results ■■ -
sp_hit_id Q499R0
Definition sp|Q499R0|ZF518_RAT Zinc finger protein 518 OS=Rattus norvegicus
Align length 35
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920511|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_A02.
(327 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q499R0|ZF518_RAT Zinc finger protein 518 OS=Rattus norvegicus... 30 3.8
sp|Q6AHZ1|Z518A_HUMAN Zinc finger protein 518A OS=Homo sapiens G... 29 6.5
sp|Q5GV21|GPDA_XANOR Glycerol-3-phosphate dehydrogenase [NAD(P)+... 29 8.5
sp|Q2NYA5|GPDA_XANOM Glycerol-3-phosphate dehydrogenase [NAD(P)+... 29 8.5
sp|Q3BZ75|GPDA_XANC5 Glycerol-3-phosphate dehydrogenase [NAD(P)+... 29 8.5
sp|Q8PQU9|GPDA_XANAC Glycerol-3-phosphate dehydrogenase [NAD(P)+... 29 8.5

>sp|Q499R0|ZF518_RAT Zinc finger protein 518 OS=Rattus norvegicus
GN=Znf518 PE=2 SV=1
Length = 1478

Score = 30.0 bits (66), Expect = 3.8
Identities = 15/35 (42%), Positives = 20/35 (57%)
Frame = +3

Query: 135 VNIVVKVLLQNEINPKLGSQTWMPRGKKPIGKKCL 239
VN++ V QNE PK T MP GK+ + KC+
Sbjct: 1071 VNVLDAVKQQNESLPKASLYTLMPDGKQAVFFKCM 1105


>sp|Q6AHZ1|Z518A_HUMAN Zinc finger protein 518A OS=Homo sapiens
GN=ZNF518A PE=1 SV=2
Length = 1483

Score = 29.3 bits (64), Expect = 6.5
Identities = 15/35 (42%), Positives = 21/35 (60%)
Frame = +3

Query: 135 VNIVVKVLLQNEINPKLGSQTWMPRGKKPIGKKCL 239
+NI V QNEI PK T++P GK+ + KC+
Sbjct: 1076 LNISDSVKQQNEIFPKPPLYTFLPDGKQAVFLKCV 1110


>sp|Q5GV21|GPDA_XANOR Glycerol-3-phosphate dehydrogenase [NAD(P)+]
OS=Xanthomonas oryzae pv. oryzae GN=gpsA PE=3 SV=2
Length = 341

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +3

Query: 105 KARHYHLERCVNIVVKVLLQNEINPKLGSQTWMPRGKKP 221
+A H+ +E ++ V+ +L EI P+ G + + R +KP
Sbjct: 295 QAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKP 333


>sp|Q2NYA5|GPDA_XANOM Glycerol-3-phosphate dehydrogenase [NAD(P)+]
OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
GN=gpsA PE=3 SV=1
Length = 341

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +3

Query: 105 KARHYHLERCVNIVVKVLLQNEINPKLGSQTWMPRGKKP 221
+A H+ +E ++ V+ +L EI P+ G + + R +KP
Sbjct: 295 QAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKP 333


>sp|Q3BZ75|GPDA_XANC5 Glycerol-3-phosphate dehydrogenase [NAD(P)+]
OS=Xanthomonas campestris pv. vesicatoria (strain 85-10)
GN=gpsA PE=3 SV=1
Length = 341

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +3

Query: 105 KARHYHLERCVNIVVKVLLQNEINPKLGSQTWMPRGKKP 221
+A H+ +E ++ V+ +L EI P+ G + + R +KP
Sbjct: 295 QAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKP 333


>sp|Q8PQU9|GPDA_XANAC Glycerol-3-phosphate dehydrogenase [NAD(P)+]
OS=Xanthomonas axonopodis pv. citri GN=gpsA PE=3 SV=1
Length = 341

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/39 (30%), Positives = 23/39 (58%)
Frame = +3

Query: 105 KARHYHLERCVNIVVKVLLQNEINPKLGSQTWMPRGKKP 221
+A H+ +E ++ V+ +L EI P+ G + + R +KP
Sbjct: 295 QAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKP 333


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920511|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_A02.
(327 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******