BP920536
Clone id YMU001_000138_C11
Library
Length 471
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000138_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCAGAACCAAATTGCCTGAACTTCTCCACATGAGCATGAAAATCATCCCCAGTAGACAG
TCCACAATTTGTATGACAATCTGGTGGTAACGGCTATACATGTTTTCCCACAGAGTTTGG
AAAATGTGATTTACAGTGACCTATTGAAACTCTCAAGCAATCTTCCTCTCCCATTATAGT
TACTTTCTCTGTGGGGCGATGATCTGTGCACCTCCCTTCTATGCCATCAACATCAATTAT
AACTTGTGCTGGATTGAGGGTCATTGATTCGATGTCCTGAGCTTCCCCAAAAAAGGGTTT
TGGGTGTGGAGACACTCCATTGGCGTTTATGTCATGTTGTTGACCATGAAATCCATGTAA
TACATCATCATCTCCATTGTTTGGTACAGAAGAATACGAAGCTTCCTCTAGCTCAGTAGT
AGAGGGATTCATATGATTTGTATCATCTGGCGCTAGCAGCAACATATTAAT
■■Homology search results ■■ -
sp_hit_id P97030
Definition sp|P97030|YHBA_BACSU Putative electron transport protein yhbA OS=Bacillus subtilis
Align length 92
Score (bit) 31.2
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920536|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_C11.
(471 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P97030|YHBA_BACSU Putative electron transport protein yhbA OS... 31 2.4
sp|Q831F9|GLYA_ENTFA Serine hydroxymethyltransferase OS=Enteroco... 30 7.1
sp|Q3SS13|ANMK_NITWN Anhydro-N-acetylmuramic acid kinase OS=Nitr... 30 7.1
sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 ... 29 9.3

>sp|P97030|YHBA_BACSU Putative electron transport protein yhbA
OS=Bacillus subtilis GN=yhbA PE=4 SV=1
Length = 435

Score = 31.2 bits (69), Expect = 2.4
Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 6/92 (6%)
Frame = -1

Query: 282 AQDIESMTLNPAQVIIDVDGIEGRCTDHRPTEKVTIMGEEDCLRV------SIGHCKSHF 121
A+ I ++ P I D+ G +C D PT + G+ + R + G F
Sbjct: 219 AEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEF 278

Query: 120 PNSVGKHV*PLPPDCHTNCGLSTGDDFHAHVE 25
+G + C T C L+ G DFH H E
Sbjct: 279 RTKIGNRLYGCDT-CQTVCPLNKGKDFHLHPE 309


>sp|Q831F9|GLYA_ENTFA Serine hydroxymethyltransferase
OS=Enterococcus faecalis GN=glyA PE=3 SV=1
Length = 412

Score = 29.6 bits (65), Expect = 7.1
Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 2/79 (2%)
Frame = -1

Query: 423 STTELEEASYSSVPNNGDDDVLHGFHGQQHDINANGVSPHPKP--FFGEAQDIESMTLNP 250
S ++ A+Y S+ GD + G D++A G H P F G+ + S ++P
Sbjct: 92 SGSQANTAAYLSLVEPGD--TILGM-----DLSAGGHLTHGSPVNFSGKTYNFVSYGVDP 144

Query: 249 AQVIIDVDGIEGRCTDHRP 193
+ +ID D + +HRP
Sbjct: 145 STEVIDYDVVRILAREHRP 163


>sp|Q3SS13|ANMK_NITWN Anhydro-N-acetylmuramic acid kinase
OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391)
GN=anmK PE=3 SV=1
Length = 366

Score = 29.6 bits (65), Expect = 7.1
Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 5/70 (7%)
Frame = -1

Query: 237 IDVDGIEGRCTDHRPTEKVTI-MGEEDCL----RVSIGHCKSHFPNSVGKHV*PLPPDCH 73
ID+ G G+ HRP E++T+ +G+ D L RV + H + G P P H
Sbjct: 96 IDIVGFHGQTVLHRPGERLTVQIGDADALAKAIRVPVMHDFRAADVAAGGQGAPFVPAYH 155

Query: 72 TNCGLSTGDD 43
S G D
Sbjct: 156 RALAQSLGRD 165


>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2
OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2
Length = 342

Score = 29.3 bits (64), Expect = 9.3
Identities = 24/110 (21%), Positives = 47/110 (42%)
Frame = -1

Query: 429 NPSTTELEEASYSSVPNNGDDDVLHGFHGQQHDINANGVSPHPKPFFGEAQDIESMTLNP 250
+P+ +L E S+PN G + F QQ+ +N H F A+ + + +
Sbjct: 71 DPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQY-VNTMQQVMHNPEFKTMAEKLGTALVQD 129

Query: 249 AQVIIDVDGIEGRCTDHRPTEKVTIMGEEDCLRVSIGHCKSHFPNSVGKH 100
Q+ +D T TE++ M E+ L+ + + P+++ K+
Sbjct: 130 PQMSPFLDAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKY 179


tr_hit_id Q98K68
Definition tr|Q98K68|Q98K68_RHILO Mlr1612 protein OS=Rhizobium loti
Align length 79
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920536|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_C11.
(471 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q98K68|Q98K68_RHILO Mlr1612 protein OS=Rhizobium loti GN=mlr1... 35 1.4
tr|B6AHM8|B6AHM8_9CRYT Helicase conserved C-terminal domain-cont... 35 1.9
tr|Q8IAM1|Q8IAM1_PLAF7 Putative uncharacterized protein MAL8P1.1... 34 3.2
tr|B0YZF7|B0YZF7_9PARA Phosphoprotein OS=Newcastle disease virus... 33 9.3

>tr|Q98K68|Q98K68_RHILO Mlr1612 protein OS=Rhizobium loti GN=mlr1612
PE=4 SV=1
Length = 309

Score = 35.4 bits (80), Expect = 1.4
Identities = 23/79 (29%), Positives = 32/79 (40%)
Frame = -1

Query: 354 GFHGQQHDINANGVSPHPKPFFGEAQDIESMTLNPAQVIIDVDGIEGRCTDHRPTEKVTI 175
GFH HD +G + P G+ D + PA+VI DVD I P V +
Sbjct: 56 GFHVYVHDHRGHGATKAPDAPLGKFADEDG----PAKVIADVDAIHDLIASECPGLPVIL 111

Query: 174 MGEEDCLRVSIGHCKSHFP 118
G V++ + H P
Sbjct: 112 FGHSMGASVALNYLLGHSP 130


>tr|B6AHM8|B6AHM8_9CRYT Helicase conserved C-terminal
domain-containing protein OS=Cryptosporidium muris RN66
GN=CMU_006460 PE=4 SV=1
Length = 1691

Score = 35.0 bits (79), Expect = 1.9
Identities = 22/52 (42%), Positives = 30/52 (57%)
Frame = -1

Query: 471 INMLLLAPDDTNHMNPSTTELEEASYSSVPNNGDDDVLHGFHGQQHDINANG 316
+N++L+ PDDT NPS T L++ SYS + N D+ FH Q H I G
Sbjct: 1469 VNVVLIIPDDTQLSNPSNT-LQQDSYSYIDTNFDN-----FH-QIHSIKLIG 1513


>tr|Q8IAM1|Q8IAM1_PLAF7 Putative uncharacterized protein MAL8P1.153
OS=Plasmodium falciparum (isolate 3D7) GN=MAL8P1.153 PE=4
SV=1
Length = 2577

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)
Frame = -1

Query: 444 DTNHMNPSTTELEEASYSSVPNNGD----DDVLHGFHGQQ---HDINANGVS 310
D N MN ELE +Y S+ NNG+ D + + + HD+N N VS
Sbjct: 1629 DNNEMNNYNHELERVTYDSINNNGNIHKGDYIKNNVYNNNYHLHDVNTNSVS 1680


>tr|B0YZF7|B0YZF7_9PARA Phosphoprotein OS=Newcastle disease virus
GN=P PE=4 SV=1
Length = 395

Score = 32.7 bits (73), Expect = 9.3
Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 12/88 (13%)
Frame = -1

Query: 459 LLAPDDTNHMNPSTTELEEASYSS-----------VPNNGDDDVLHGFHGQQHDINAN-G 316
L +P + +H P+ + SY S VP N D +HGQ+ ++ + G
Sbjct: 136 LSSPQEGHHQPPAQQHGNQPSYGSDQGRPQHQAKAVPGNRGTDENTAYHGQRKELQPSAG 195

Query: 315 VSPHPKPFFGEAQDIESMTLNPAQVIID 232
+PH P G++QD + ++ Q+ D
Sbjct: 196 ATPH-APQSGQSQDNTPVPVDRVQLPAD 222