BP920547
Clone id YMU001_000138_D10
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000138_D10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCAGCTCGAGTAAGCCTTGGCACATGACCAAGTCCTGCATGATTGAGGTATTCAACAAAC
TCGTTCCTTGCAAACCATGGAAGATCAATCGCACTATAAAACCATTCATAGATACACCAC
CGCCTAACTTTCTCAGATGAGAGGCAATGAGCAAGCCTAACCTTATTACTATATTTCTCT
TCTGCCACCACTGCATGTGAGCAATGACAAGTGGCTACTGATAGTGCAGAAGACTTGGAC
TTCTGCCTGCTTCTTTGTTTTCTAAAAGTGTAGTTCATTCTTTCTACTGCAGGACCTATC
TCTACTTCTGATTCACCAATAACCACATCTTGTCGATCAAGCTCTTGATCCGGCTCCTGT
TTAACAGGCTTCGCTGTGTACTTGCCTAGGGTTTGTCCCTGCACAACTCGTTTCAGCTTG
GTACGAGCCATCAGATCTTCAGACTGCAGATTTGCAACCTTTGCCTCCGTCATATCCTCT
TCGGCAATGCTTCCATGAGAAAATTGATCCCTCTTTTC
■■Homology search results ■■ -
sp_hit_id Q8C735
Definition sp|Q8C735|LIN9_MOUSE Lin-9 homolog OS=Mus musculus
Align length 39
Score (bit) 43.9
E-value 0.0005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920547|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_D10.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8C735|LIN9_MOUSE Lin-9 homolog OS=Mus musculus GN=Lin9 PE=2 ... 44 5e-04
sp|Q4R8N2|LIN9_MACFA Lin-9 homolog OS=Macaca fascicularis GN=LIN... 44 5e-04
sp|Q5TKA1|LIN9_HUMAN Lin-9 homolog OS=Homo sapiens GN=LIN9 PE=1 ... 44 5e-04
sp|Q5RHQ8|LIN9_DANRE Lin-9 homolog OS=Danio rerio GN=lin9 PE=3 SV=1 44 6e-04
sp|Q64UQ7|GCSP_BACFR Glycine dehydrogenase [decarboxylating] OS=... 34 0.36
sp|Q5LDN2|GCSP_BACFN Glycine dehydrogenase [decarboxylating] OS=... 34 0.36
sp|P30630|LIN9_CAEEL Protein lin-9 OS=Caenorhabditis elegans GN=... 31 3.0
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Sacc... 31 4.0
sp|P56299|RPOB_CHLVU DNA-directed RNA polymerase subunit beta OS... 30 5.2
sp|Q3UDE2|TTL12_MOUSE Tubulin--tyrosine ligase-like protein 12 O... 30 6.8
sp|Q9L7Z3|GRPE_VIBPR Protein grpE OS=Vibrio proteolyticus GN=grp... 30 8.8
sp|A7ER98|CHZ1_SCLS1 Histone H2A.Z-specific chaperone chz1 OS=Sc... 30 8.8

>sp|Q8C735|LIN9_MOUSE Lin-9 homolog OS=Mus musculus GN=Lin9 PE=2
SV=2
Length = 542

Score = 43.9 bits (102), Expect = 5e-04
Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
Frame = -1

Query: 182 EEKYSNKV--RLAHCLSSEKVRRWCIYEWFYSAIDLPWF 72
++K S K+ RL + L K +WCIYEWFYS ID P F
Sbjct: 98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLF 136


>sp|Q4R8N2|LIN9_MACFA Lin-9 homolog OS=Macaca fascicularis GN=LIN9
PE=2 SV=1
Length = 542

Score = 43.9 bits (102), Expect = 5e-04
Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
Frame = -1

Query: 182 EEKYSNKV--RLAHCLSSEKVRRWCIYEWFYSAIDLPWF 72
++K S K+ RL + L K +WCIYEWFYS ID P F
Sbjct: 98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLF 136


>sp|Q5TKA1|LIN9_HUMAN Lin-9 homolog OS=Homo sapiens GN=LIN9 PE=1
SV=1
Length = 542

Score = 43.9 bits (102), Expect = 5e-04
Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
Frame = -1

Query: 182 EEKYSNKV--RLAHCLSSEKVRRWCIYEWFYSAIDLPWF 72
++K S K+ RL + L K +WCIYEWFYS ID P F
Sbjct: 98 DKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLF 136


>sp|Q5RHQ8|LIN9_DANRE Lin-9 homolog OS=Danio rerio GN=lin9 PE=3 SV=1
Length = 543

Score = 43.5 bits (101), Expect = 6e-04
Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
Frame = -1

Query: 200 SHAVVAEEKYSNKV--RLAHCLSSEKVRRWCIYEWFYSAIDLPWF 72
++ +++ S K+ RL + L K +WCIYEWFYS ID P F
Sbjct: 90 TNVATPDKRVSQKIGLRLRNLLKLPKAHKWCIYEWFYSNIDRPLF 134


>sp|Q64UQ7|GCSP_BACFR Glycine dehydrogenase [decarboxylating]
OS=Bacteroides fragilis GN=gcvP PE=3 SV=1
Length = 949

Score = 34.3 bits (77), Expect = 0.36
Identities = 28/116 (24%), Positives = 49/116 (42%)
Frame = -1

Query: 479 EDMTEAKVANLQSEDLMARTKLKRVVQGQTLGKYTAKPVKQEPDQELDRQDVVIGESEVE 300
+D+ EA + SE+L +T + + KY + + LDR+D+ + +S +
Sbjct: 451 DDIPEATII---SEELKRQTPY---LTHEVFSKYHTETEMMRYIKRLDRKDISLAQSMIS 504

Query: 299 IGPAVERMNYTFXXXXXXXXXXXSALSVATCHCSHAVVAEEKYSNKVRLAHCLSSE 132
+G ++N LS A C H +V E++ + L H LS E
Sbjct: 505 LGSCTMKLN---------AAAEMLPLSCAEFMCMHPLVPEDQAAGYRELIHNLSEE 551


>sp|Q5LDN2|GCSP_BACFN Glycine dehydrogenase [decarboxylating]
OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343)
GN=gcvP PE=3 SV=1
Length = 949

Score = 34.3 bits (77), Expect = 0.36
Identities = 28/116 (24%), Positives = 49/116 (42%)
Frame = -1

Query: 479 EDMTEAKVANLQSEDLMARTKLKRVVQGQTLGKYTAKPVKQEPDQELDRQDVVIGESEVE 300
+D+ EA + SE+L +T + + KY + + LDR+D+ + +S +
Sbjct: 451 DDIPEATII---SEELKRQTPY---LTHEVFSKYHTETEMMRYIKRLDRKDISLAQSMIS 504

Query: 299 IGPAVERMNYTFXXXXXXXXXXXSALSVATCHCSHAVVAEEKYSNKVRLAHCLSSE 132
+G ++N LS A C H +V E++ + L H LS E
Sbjct: 505 LGSCTMKLN---------AAAEMLPLSCAEFMCMHPLVPEDQAAGYRELIHNLSEE 551


>sp|P30630|LIN9_CAEEL Protein lin-9 OS=Caenorhabditis elegans
GN=lin-9 PE=1 SV=3
Length = 644

Score = 31.2 bits (69), Expect = 3.0
Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
Frame = -1

Query: 170 SNKVRLAHCLSSEKVRRWCIYEWFYSAIDLPWF-ARNEFVEYLNHA 36
+N +L + L +K R+W + E+FYSAID F NEF + +
Sbjct: 203 ANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRES 248


>sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9
OS=Saccharomyces cerevisiae GN=AVL9 PE=1 SV=1
Length = 764

Score = 30.8 bits (68), Expect = 4.0
Identities = 20/60 (33%), Positives = 30/60 (50%)
Frame = -1

Query: 485 AEEDMTEAKVANLQSEDLMARTKLKRVVQGQTLGKYTAKPVKQEPDQELDRQDVVIGESE 306
A ED+TE+ +EDL R+K +Q +G + +PD E D+Q +G SE
Sbjct: 553 ANEDVTES------TEDLKNRSKTSNAIQKAMMGL----GLHYKPDAETDQQSEEVGNSE 602


>sp|P56299|RPOB_CHLVU DNA-directed RNA polymerase subunit beta
OS=Chlorella vulgaris GN=rpoB PE=3 SV=1
Length = 1301

Score = 30.4 bits (67), Expect = 5.2
Identities = 12/32 (37%), Positives = 16/32 (50%)
Frame = +2

Query: 410 VSAWYEPSDLQTADLQPLPPSYPLRQCFHEKI 505
+ +W EP D + PL P P Q HEK+
Sbjct: 939 IGSWVEPGDYLVGKMSPLDPKSPPLQSPHEKL 970


>sp|Q3UDE2|TTL12_MOUSE Tubulin--tyrosine ligase-like protein 12
OS=Mus musculus GN=Ttll12 PE=2 SV=1
Length = 639

Score = 30.0 bits (66), Expect = 6.8
Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 5/51 (9%)
Frame = -1

Query: 194 AVVAEE--KYSNKVRLAHCLSSEKVRRWCIYEWFYSAI---DLPWFARNEF 57
A+V EE K++ +LAH + EKV W I + F S I D+P FA F
Sbjct: 159 ALVLEEMWKFNQTYQLAHGTAEEKVPVWYIMDEFGSRIQHSDMPSFATAPF 209


tr_hit_id A9RVZ7
Definition tr|A9RVZ7|A9RVZ7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 66
Score (bit) 101.0
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920547|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_D10.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RVZ7|A9RVZ7_PHYPA Predicted protein OS=Physcomitrella paten... 101 2e-20
tr|Q9LIF3|Q9LIF3_ARATH Genomic DNA, chromosome 3, P1 clone:MHC9 ... 97 6e-19
tr|Q6A332|Q6A332_ARATH Always early protein 3 OS=Arabidopsis tha... 97 6e-19
tr|Q0WLW8|Q0WLW8_ARATH Putative uncharacterized protein At3g2143... 97 6e-19
tr|A7NW60|A7NW60_VITVI Chromosome chr5 scaffold_2, whole genome ... 94 3e-18
tr|A5AVL5|A5AVL5_VITVI Putative uncharacterized protein OS=Vitis... 94 3e-18
tr|Q6AUE7|Q6AUE7_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 93 7e-18
tr|Q10G93|Q10G93_ORYSJ DIRP family protein, expressed OS=Oryza s... 93 7e-18
tr|Q10G92|Q10G92_ORYSJ DIRP family protein, expressed OS=Oryza s... 93 7e-18
tr|Q0DQ40|Q0DQ40_ORYSJ Os03g0639200 protein OS=Oryza sativa subs... 93 7e-18
tr|B8AN37|B8AN37_ORYSI Putative uncharacterized protein OS=Oryza... 93 7e-18
tr|Q6A331|Q6A331_ARATH Always early 1 protein OS=Arabidopsis tha... 92 2e-17
tr|Q5SNG2|Q5SNG2_ORYSJ Always early 1 protein-like OS=Oryza sati... 89 2e-16
tr|Q0JPY1|Q0JPY1_ORYSJ Os01g0193900 protein (Fragment) OS=Oryza ... 89 2e-16
tr|B8ADQ4|B8ADQ4_ORYSI Putative uncharacterized protein OS=Oryza... 89 2e-16
tr|A2ZQ81|A2ZQ81_ORYSJ Putative uncharacterized protein OS=Oryza... 89 2e-16
tr|Q9MA51|Q9MA51_ARATH F22F7.18 protein OS=Arabidopsis thaliana ... 82 1e-14
tr|Q8RXZ0|Q8RXZ0_ARATH Putative uncharacterized protein At3g0538... 82 1e-14
tr|Q6A333|Q6A333_ARATH Always early 2 protein OS=Arabidopsis tha... 82 1e-14
tr|A7PS74|A7PS74_VITVI Chromosome chr14 scaffold_27, whole genom... 81 4e-14
tr|A9SYB3|A9SYB3_PHYPA Predicted protein OS=Physcomitrella paten... 70 6e-11
tr|Q4RR02|Q4RR02_TETNG Chromosome 14 SCAF15003, whole genome sho... 48 3e-04
tr|Q5ZMF8|Q5ZMF8_CHICK Putative uncharacterized protein OS=Gallu... 44 0.005
tr|Q8IWQ2|Q8IWQ2_HUMAN TGS1 OS=Homo sapiens PE=2 SV=1 44 0.005
tr|Q8IWQ1|Q8IWQ1_HUMAN TGS2 OS=Homo sapiens PE=2 SV=1 44 0.005
tr|Q6P142|Q6P142_HUMAN LIN9 protein (Fragment) OS=Homo sapiens G... 44 0.005
tr|B1B046|B1B046_HUMAN Lin-9 homolog (C. elegans) OS=Homo sapien... 44 0.005
tr|B1ANK3|B1ANK3_HUMAN Lin-9 homolog (C. elegans) OS=Homo sapien... 44 0.005
tr|Q08BJ0|Q08BJ0_DANRE Lin9 protein OS=Danio rerio GN=lin9 PE=2 ... 44 0.006
tr|B7PM50|B7PM50_IXOSC Lin-9, putative (Fragment) OS=Ixodes scap... 44 0.006

>tr|A9RVZ7|A9RVZ7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161252 PE=4 SV=1
Length = 1323

Score = 101 bits (252), Expect = 2e-20
Identities = 47/66 (71%), Positives = 50/66 (75%)
Frame = -1

Query: 203 CSHAVVAEEKYSNKVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGH 24
C H S K ++ HCL KVRRWC+ EWFYSAIDLPWFARNEFVEYLNHAGLGH
Sbjct: 678 CPHTTPELGTDSAKAKIIHCLCP-KVRRWCMCEWFYSAIDLPWFARNEFVEYLNHAGLGH 736

Query: 23 VPRLTR 6
VPRLTR
Sbjct: 737 VPRLTR 742


>tr|Q9LIF3|Q9LIF3_ARATH Genomic DNA, chromosome 3, P1 clone:MHC9
OS=Arabidopsis thaliana PE=4 SV=1
Length = 1128

Score = 96.7 bits (239), Expect = 6e-19
Identities = 39/51 (76%), Positives = 45/51 (88%)
Frame = -1

Query: 158 RLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
+ +HC+SS + RRWCI+EWFYSAID PWFAR EFVEYL+H GLGHVPRLTR
Sbjct: 585 KFSHCISSFRARRWCIFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTR 635


>tr|Q6A332|Q6A332_ARATH Always early protein 3 OS=Arabidopsis
thaliana GN=Ataly3 PE=2 SV=1
Length = 1132

Score = 96.7 bits (239), Expect = 6e-19
Identities = 39/51 (76%), Positives = 45/51 (88%)
Frame = -1

Query: 158 RLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
+ +HC+SS + RRWCI+EWFYSAID PWFAR EFVEYL+H GLGHVPRLTR
Sbjct: 589 KFSHCISSFRARRWCIFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTR 639


>tr|Q0WLW8|Q0WLW8_ARATH Putative uncharacterized protein At3g21430
(Fragment) OS=Arabidopsis thaliana GN=At3g21430 PE=2
SV=1
Length = 569

Score = 96.7 bits (239), Expect = 6e-19
Identities = 39/51 (76%), Positives = 45/51 (88%)
Frame = -1

Query: 158 RLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
+ +HC+SS + RRWCI+EWFYSAID PWFAR EFVEYL+H GLGHVPRLTR
Sbjct: 26 KFSHCISSFRARRWCIFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTR 76


>tr|A7NW60|A7NW60_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019794001
PE=4 SV=1
Length = 935

Score = 94.4 bits (233), Expect = 3e-18
Identities = 39/53 (73%), Positives = 46/53 (86%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K +L++CLS +VRRWC +EWFYSAID PWFA+ EFVEYL+H GLGHVPRLTR
Sbjct: 567 KEKLSNCLSCYRVRRWCAFEWFYSAIDYPWFAKKEFVEYLDHVGLGHVPRLTR 619


>tr|A5AVL5|A5AVL5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000119 PE=4 SV=1
Length = 928

Score = 94.4 bits (233), Expect = 3e-18
Identities = 39/53 (73%), Positives = 46/53 (86%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K +L++CLS +VRRWC +EWFYSAID PWFA+ EFVEYL+H GLGHVPRLTR
Sbjct: 320 KEKLSNCLSCYRVRRWCAFEWFYSAIDYPWFAKKEFVEYLDHVGLGHVPRLTR 372


>tr|Q6AUE7|Q6AUE7_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0029I19.5 PE=4 SV=1
Length = 1251

Score = 93.2 bits (230), Expect = 7e-18
Identities = 39/53 (73%), Positives = 44/53 (83%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K L+HCLSS +RRWC +EWFYSAID PWF ++EFVEYLNH LGHVPRLTR
Sbjct: 690 KDSLSHCLSSRLLRRWCTFEWFYSAIDFPWFEKSEFVEYLNHVKLGHVPRLTR 742


>tr|Q10G93|Q10G93_ORYSJ DIRP family protein, expressed OS=Oryza
sativa subsp. japonica GN=LOC_Os03g43800 PE=4 SV=1
Length = 1255

Score = 93.2 bits (230), Expect = 7e-18
Identities = 39/53 (73%), Positives = 44/53 (83%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K L+HCLSS +RRWC +EWFYSAID PWF ++EFVEYLNH LGHVPRLTR
Sbjct: 694 KDSLSHCLSSRLLRRWCTFEWFYSAIDFPWFEKSEFVEYLNHVKLGHVPRLTR 746


>tr|Q10G92|Q10G92_ORYSJ DIRP family protein, expressed OS=Oryza
sativa subsp. japonica GN=LOC_Os03g43800 PE=4 SV=1
Length = 1246

Score = 93.2 bits (230), Expect = 7e-18
Identities = 39/53 (73%), Positives = 44/53 (83%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K L+HCLSS +RRWC +EWFYSAID PWF ++EFVEYLNH LGHVPRLTR
Sbjct: 694 KDSLSHCLSSRLLRRWCTFEWFYSAIDFPWFEKSEFVEYLNHVKLGHVPRLTR 746


>tr|Q0DQ40|Q0DQ40_ORYSJ Os03g0639200 protein OS=Oryza sativa subsp.
japonica GN=Os03g0639200 PE=4 SV=1
Length = 1272

Score = 93.2 bits (230), Expect = 7e-18
Identities = 39/53 (73%), Positives = 44/53 (83%)
Frame = -1

Query: 164 KVRLAHCLSSEKVRRWCIYEWFYSAIDLPWFARNEFVEYLNHAGLGHVPRLTR 6
K L+HCLSS +RRWC +EWFYSAID PWF ++EFVEYLNH LGHVPRLTR
Sbjct: 699 KDSLSHCLSSRLLRRWCTFEWFYSAIDFPWFEKSEFVEYLNHVKLGHVPRLTR 751