BP920580
Clone id YMU001_000138_G09
Library
Length 552
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000138_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGCGGGGAATGACTCGTTGGATTCCTCTAACCTAGAACTACATGCACGTCATGCCAAA
TGCCCACCATAGTGTAAAAACATCCTCAAAACACTGGTACAATCCACTTATGCAAGAGGG
TTCCAAATCCCCCACAGGTACACAGTTCTATCACGAAAGATTGAGAATTTGGAGAGTTTT
CTCACGTGAGAACTCATCCAAATTATAGGGGAACTATCCCATTGCAAGCGGGAGCCCTTA
GGACACGCGTAAACGTGTTCGCTCCACTAAAAAACAAAGAATTACAGCCTGCTGTGTTTT
TTATGCAAGTTTAGGGTTTCGCACCTAAACTGCAAGACAACACCAGGTATTAGGTAAAGG
CGGTGTGCCTCACCGTGCTTTGCCCGTGTCCGCCGGCCAGTGTCCAGCTGCCCATATTTA
TCTCCTTATTCTTTATACATAAAAAGAATAAGGAGCTCTCACTCACATTCTCACATGATG
CTCACACAGTGAGATTTGGGAGCTGCACTCACATCTCGTGTTGTGCTCTCTCTCCCCTTC
GCACTCTCTGCA
■■Homology search results ■■ -
sp_hit_id A8QW39
Definition sp|A8QW39|F183A_BOVIN Protein FAM183A OS=Bos taurus
Align length 40
Score (bit) 33.5
E-value 0.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920580|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_G09.
(552 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A8QW39|F183A_BOVIN Protein FAM183A OS=Bos taurus GN=FAM183A P... 33 0.70
sp|Q9MV48|MATK_PSEMZ Maturase K OS=Pseudotsuga menziesii GN=matK... 32 1.6
sp|Q2VPA4|CR1L_HUMAN Complement component receptor 1-like protei... 31 4.6
sp|Q7IJL0|MATK_LARLA Maturase K OS=Larix laricina GN=matK PE=3 SV=1 30 7.8

>sp|A8QW39|F183A_BOVIN Protein FAM183A OS=Bos taurus GN=FAM183A PE=2
SV=1
Length = 135

Score = 33.5 bits (75), Expect = 0.70
Identities = 12/40 (30%), Positives = 24/40 (60%)
Frame = -2

Query: 239 KGSRLQWDSSPIIWMSSHVRKLSKFSIFRDRTVYLWGIWN 120
+G + WDS P++ R+L+ F +++D T+Y +W+
Sbjct: 88 EGQEIGWDSEPLVNPQRDDRRLNHFRVYKDITLYKAKMWS 127


>sp|Q9MV48|MATK_PSEMZ Maturase K OS=Pseudotsuga menziesii GN=matK
PE=3 SV=1
Length = 515

Score = 32.3 bits (72), Expect = 1.6
Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)
Frame = -2

Query: 371 EAHRLYLIPGVVLQFRCETLNLHKK-----HSRL*FFVF*WSEHVYACPKGSRLQWDSSP 207
+A L+L+ V+ ++R + NL + FF+F W+ +VY C + P
Sbjct: 170 DAPSLHLLRSVLYEYRNSSENLQRSLIVAPRVNTRFFLFLWNHYVYEC------ESILVP 223

Query: 206 IIWMSSHVRKLSKFSIFRDRT 144
++ SSH R LS S F +RT
Sbjct: 224 LLKRSSHSRSLSHGS-FPERT 243


>sp|Q2VPA4|CR1L_HUMAN Complement component receptor 1-like protein
OS=Homo sapiens GN=CR1L PE=1 SV=2
Length = 569

Score = 30.8 bits (68), Expect = 4.6
Identities = 22/66 (33%), Positives = 32/66 (48%)
Frame = -2

Query: 263 SEHVYACPKGSRLQWDSSPIIWMSSHVRKLSKFSIFRDRTVYLWGIWNPLA*VDCTSVLR 84
S+ Y+CPKG RL SS +S + + DR + G+ +A D TS+ R
Sbjct: 117 SQIKYSCPKGYRLIGSSSATCIISGNTVIWDNKTPVCDRII--CGLPPTIANGDFTSISR 174

Query: 83 MFLHYG 66
+ HYG
Sbjct: 175 EYFHYG 180


>sp|Q7IJL0|MATK_LARLA Maturase K OS=Larix laricina GN=matK PE=3 SV=1
Length = 515

Score = 30.0 bits (66), Expect = 7.8
Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 5/81 (6%)
Frame = -2

Query: 371 EAHRLYLIPGVVLQFRCETLNLHKK-----HSRL*FFVF*WSEHVYACPKGSRLQWDSSP 207
+A L+ + V+ ++R NL + FF+F W+ +VY C + P
Sbjct: 170 DAPSLHPLRSVLYEYRNSPENLQRSIIVAPRVNTRFFLFLWNHYVYEC------ESILVP 223

Query: 206 IIWMSSHVRKLSKFSIFRDRT 144
++ SSH+R LS S F +RT
Sbjct: 224 LLKRSSHLRSLSHGS-FPERT 243


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920580|Adiantum capillus-veneris mRNA, clone:
YMU001_000138_G09.
(552 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******