BP920594
Clone id YMU001_000139_A04
Library
Length 412
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_A04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATCGCCCTGCCACGTTATCACTGATGAAAATTACCCCCTAACAACATCGGCTATTGCGC
ACTACCCTCGTCCACAAAAACCATCATAAATGCCCACTAGCTCCAAATACTGGCCGCCAC
ACACTGTGCGCAAAGCGCCACCATAGCCTACGAGCTTGGGAGAGCTCCCCTCTCCTTCTC
CTTGTACACTATGGGAGGGTTTACTCCCATTATAAATATCCACCCCCATATACCATGTGC
CTGCATGTGGGATATAAGCTCTACCACCATGGCACTCCCACATCAACGCTCTCCAAAACC
ACTTGAAAATTCCCATAATGTGGTACATGAAAGAACTTTTTCTATCATAAAATCTAATAT
CTCACCAGCCCAAATGATTTTCTCATATTAAACTGGTCATTTAATGTGGGAG
■■Homology search results ■■ -
sp_hit_id A1D731
Definition sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
Align length 80
Score (bit) 32.3
E-value 0.76
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920594|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_A04.
(412 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya... 32 0.76
sp|P36011|STUA_EMENI Cell pattern formation-associated protein s... 32 1.00
sp|Q1E0A3|MCA1_COCIM Metacaspase-1 OS=Coccidioides immitis GN=MC... 32 1.3
sp|Q38913|EXTN1_ARATH Extensin-1 OS=Arabidopsis thaliana GN=EXT1... 31 2.2
sp|Q6DCV1|AB1IP_XENLA Amyloid beta A4 precursor protein-binding ... 31 2.2
sp|Q6NSV7|F149B_MOUSE Protein FAM149B1 OS=Mus musculus GN=Fam149... 30 2.9
sp|Q42533|BCCP1_ARATH Biotin carboxyl carrier protein of acetyl-... 30 3.8
sp|Q9SS38|GYRBP_ARATH Probable DNA gyrase subunit B, chloroplast... 30 4.9
sp|Q2UPS5|PNG1_ASPOR Protein png1 OS=Aspergillus oryzae GN=png1 ... 30 5.0
sp|Q9U1M8|MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium disco... 30 5.0
sp|P24152|EXTN_SORBI Extensin OS=Sorghum bicolor GN=HRGP PE=3 SV=1 30 5.0
sp|Q5ZID5|UBP28_CHICK Ubiquitin carboxyl-terminal hydrolase 28 O... 29 6.5
sp|Q2NU68|MGSA_SODGM Methylglyoxal synthase OS=Sodalis glossinid... 29 6.5
sp|P51856|K1C19_POTTR Keratin, type I cytoskeletal 19 OS=Potorou... 29 6.5
sp|Q86YZ3|HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 29 6.5
sp|P29293|ACRO_RAT Acrosin OS=Rattus norvegicus GN=Acr PE=2 SV=2 29 6.5
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditi... 29 6.5
sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 29 6.5
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abe... 29 8.4
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus muscu... 29 8.4
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapi... 29 8.4
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos tauru... 29 8.4
sp|Q7TPN3|PIGV_MOUSE GPI mannosyltransferase 2 OS=Mus musculus G... 29 8.4
sp|P32166|MENA_ECOLI 1,4-dihydroxy-2-naphthoate octaprenyltransf... 29 8.4
sp|Q6BSP4|BBP_DEBHA Branchpoint-bridging protein OS=Debaryomyces... 29 8.5

>sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya
fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
GN=nst1 PE=3 SV=1
Length = 1193

Score = 32.3 bits (72), Expect = 0.76
Identities = 21/80 (26%), Positives = 37/80 (46%)
Frame = +2

Query: 158 GRAPLSFSLYTMGGFTPIINIHPHIPCACMWDISSTTMALPHQRSPKPLENSHNVVHERT 337
G P+ +L+ + GF+P + PH+P A + T A P Q S + +S +
Sbjct: 681 GPVPIPSNLHHLQGFSPAVAHSPHVPSATPVLPKAPTPARPRQPSQQDSHSSSPHSQAPS 740

Query: 338 FSIIKSNISPAQMIFSY*TG 397
++++SP M S +G
Sbjct: 741 TDPSQASLSPRSMPVSQSSG 760


>sp|P36011|STUA_EMENI Cell pattern formation-associated protein stuA
OS=Emericella nidulans GN=stuA PE=2 SV=2
Length = 622

Score = 32.0 bits (71), Expect = 1.00
Identities = 18/56 (32%), Positives = 27/56 (48%)
Frame = +3

Query: 21 TDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCT 188
T ++P T A+ HY PQ+P + +S Y P + + P P S+ S P T
Sbjct: 22 TYASHPATAGALTHYQYPQQPPVLQPTSTYGPASSYSQYPY-PNSVASSQSVPPPT 76


>sp|Q1E0A3|MCA1_COCIM Metacaspase-1 OS=Coccidioides immitis GN=MCA1
PE=3 SV=1
Length = 462

Score = 31.6 bits (70), Expect = 1.3
Identities = 18/50 (36%), Positives = 20/50 (40%)
Frame = +3

Query: 33 YPLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSP 182
YP +S H P PQ P P PPH PP G LP +P
Sbjct: 65 YPPHSSPYGHTPSPQPPYGHPPPQH--PPHQPPHRPPPSPGYGHLPPSTP 112


>sp|Q38913|EXTN1_ARATH Extensin-1 OS=Arabidopsis thaliana GN=EXT1
PE=2 SV=2
Length = 373

Score = 30.8 bits (68), Expect = 2.2
Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 2/74 (2%)
Frame = +3

Query: 54 IAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCTLWEGLLPL*ISTP-- 227
+ HY P P KY+ P V K+PP P SP P P+ S P
Sbjct: 214 VKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVHY----SPPPVVYHSPPPPVHYSPPPV 269

Query: 228 IYHVPACGI*ALPP 269
+YH P + PP
Sbjct: 270 VYHSPPPPVHYSPP 283


>sp|Q6DCV1|AB1IP_XENLA Amyloid beta A4 precursor protein-binding
family B member 1-interacting protein OS=Xenopus laevis
GN=apbb1ip PE=2 SV=2
Length = 653

Score = 30.8 bits (68), Expect = 2.2
Identities = 16/51 (31%), Positives = 23/51 (45%)
Frame = +3

Query: 36 PLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCT 188
P+T +++ P P P P + PP V+K PP P + P P T
Sbjct: 575 PVTQLQMSNAPAPPPPPPPPAPAANVPPLPVKKHPPKPPKRQSIVGPMPGT 625


>sp|Q6NSV7|F149B_MOUSE Protein FAM149B1 OS=Mus musculus GN=Fam149b1
PE=2 SV=1
Length = 578

Score = 30.4 bits (67), Expect = 2.9
Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 18/97 (18%)
Frame = +3

Query: 15 VITDENYP-----LTTSAIAHYPR------PQKPS*MPTSSKY------WPPHTVRKAPP 143
V+++ N+P L+TS++++ + P + P S+ + WP + + P
Sbjct: 391 VLSNRNWPNRAMELSTSSLSYTTQSARRRNPPPRTLHPISTSHSRAGTPWPVEEILRGPR 450

Query: 144 *PTSLGELPSPSPCTLW-EGLLPL*ISTPIYHVPACG 251
P + L SPSP TL LLP + + H+ A G
Sbjct: 451 VPVTADTLSSPSPMTLGRNNLLPPIGTVEVEHLSAMG 487


>sp|Q42533|BCCP1_ARATH Biotin carboxyl carrier protein of acetyl-CoA
carboxylase 1, chloroplastic OS=Arabidopsis thaliana
GN=BCCP1 PE=1 SV=2
Length = 280

Score = 30.0 bits (66), Expect = 3.8
Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 4/71 (5%)
Frame = +3

Query: 51 AIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCTLWEGLLPL*ISTPI 230
A A Y Q+P+ + + PP A P P++ LP PSP T + LP + +P+
Sbjct: 152 APASYVMMQQPNQPSYAQQMAPPAAPAAAAPAPSTPASLPPPSPPTPAKSSLPT-VKSPM 210

Query: 231 ----YHVPACG 251
Y PA G
Sbjct: 211 AGTFYRSPAPG 221


>sp|Q9SS38|GYRBP_ARATH Probable DNA gyrase subunit B, chloroplastic
OS=Arabidopsis thaliana GN=GYRBC PE=3 SV=1
Length = 657

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/37 (35%), Positives = 22/37 (59%)
Frame = -1

Query: 211 NGSKPSHSVQGEGEGSSPKLVGYGGALRTVCGGQYLE 101
NGS S+Q + S ++GY ++RT+ GG ++E
Sbjct: 267 NGSTVDVSLQWCSDAYSDTMLGYANSIRTIDGGTHIE 303


>sp|Q2UPS5|PNG1_ASPOR Protein png1 OS=Aspergillus oryzae GN=png1
PE=3 SV=1
Length = 457

Score = 29.6 bits (65), Expect = 5.0
Identities = 17/44 (38%), Positives = 20/44 (45%)
Frame = +3

Query: 51 AIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSP 182
A H P P PS + + Y PPH R PP PT+ P P
Sbjct: 44 ARTHSPSPS-PSQVSSPGPYAPPHPSRAPPPPPTAAPFQPPQYP 86


>sp|Q9U1M8|MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum
GN=myoI PE=1 SV=1
Length = 2357

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/102 (21%), Positives = 43/102 (42%)
Frame = +3

Query: 15 VITDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCTLW 194
+++D P +A P P+ ++ PP ++ + P +G LP P P ++
Sbjct: 1676 LLSDVPPPQPVHPVATLSPPMSPTIPNITNTPPPPPSISDSMSPPPQVGMLPPPPPPSVM 1735

Query: 195 EGLLPL*ISTPIYHVPACGI*ALPPWHSHINALQNHLKIPIM 320
P+ +P+ GI PP S+ + + + P+M
Sbjct: 1736 GSTKPI-------EIPSLGIPPPPPSSSNSSVPNSPIGSPMM 1770


tr_hit_id Q40502
Definition tr|Q40502|Q40502_TOBAC Extensin OS=Nicotiana tabacum
Align length 76
Score (bit) 37.7
E-value 0.29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920594|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_A04.
(412 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q40502|Q40502_TOBAC Extensin OS=Nicotiana tabacum PE=3 SV=1 38 0.29
tr|Q6K296|Q6K296_ORYSJ Putative uncharacterized protein B1080A02... 37 0.38
tr|Q9VZB2|Q9VZB2_DROME CG13722 OS=Drosophila melanogaster GN=CG1... 37 0.65
tr|Q5CK29|Q5CK29_CRYHO Putative uncharacterized protein OS=Crypt... 37 0.65
tr|B4PI85|B4PI85_DROYA GE20610 OS=Drosophila yakuba GN=GE20610 P... 37 0.65
tr|Q06802|Q06802_TOBAC Extensin OS=Nicotiana tabacum GN=HRGP PE=... 36 1.1
tr|Q06446|Q06446_SOLTU Extensin OS=Solanum tuberosum PE=2 SV=1 36 1.1
tr|B3NC50|B3NC50_DROER GG14181 OS=Drosophila erecta GN=GG14181 P... 36 1.1
tr|Q2RBH4|Q2RBH4_ORYSJ Transposon protein, putative, CACTA, En/S... 35 1.4
tr|A5JVC8|A5JVC8_BRACM Putative uncharacterized protein OS=Brass... 35 1.4
tr|A8NQG0|A8NQG0_COPC7 Predicted protein OS=Coprinopsis cinerea ... 35 1.4
tr|Q5W1I2|Q5W1I2_NICGL Putative extensin (Fragment) OS=Nicotiana... 35 1.9
tr|Q40402|Q40402_NICPL Extensin (ext) OS=Nicotiana plumbaginifol... 35 1.9
tr|Q59UP8|Q59UP8_CANAL Putative uncharacterized protein MEP2 OS=... 35 2.4
tr|Q1LY54|Q1LY54_DANRE Novel protein similar to vertebrate Ets2 ... 35 2.5
tr|B7ZVP1|B7ZVP1_DANRE Erf protein OS=Danio rerio GN=erf PE=2 SV=1 35 2.5
tr|B6VC31|B6VC31_9ABAC VP78 OS=Iragoides fasciata nucleopolyhedr... 35 2.5
tr|B5DW23|B5DW23_DROPS GA26236 OS=Drosophila pseudoobscura pseud... 35 2.5
tr|B3SST4|B3SST4_BEMTA AChE1 OS=Bemisia tabaci GN=ace1 PE=2 SV=1 34 4.2
tr|B3SST3|B3SST3_BEMTA AChE1 OS=Bemisia tabaci GN=ace1 PE=2 SV=1 34 4.2
tr|A5E3X2|A5E3X2_LODEL Ammonium transporter MEP2 OS=Lodderomyces... 33 5.4
tr|Q8I4M6|Q8I4M6_CAEEL Protein C31C9.6, partially confirmed by t... 33 5.5
tr|Q5WRU4|Q5WRU4_CAEEL Putative uncharacterized protein OS=Caeno... 33 5.5
tr|B6PL80|B6PL80_BRAFL Putative uncharacterized protein OS=Branc... 33 5.5
tr|Q94ES3|Q94ES3_PEA Root nodule extensin (Fragment) OS=Pisum sa... 33 7.1
tr|B6TT12|B6TT12_MAIZE Putative uncharacterized protein OS=Zea m... 33 7.1
tr|A2ZAP9|A2ZAP9_ORYSI Putative uncharacterized protein OS=Oryza... 33 7.1
tr|B0DNP7|B0DNP7_LACBS Predicted protein OS=Laccaria bicolor (st... 33 7.1
tr|B0WPJ7|B0WPJ7_CULQU Ca-activated cl channel protein OS=Culex ... 26 8.8
tr|Q8ZW88|Q8ZW88_PYRAE Putative uncharacterized protein PAE1915 ... 33 9.3

>tr|Q40502|Q40502_TOBAC Extensin OS=Nicotiana tabacum PE=3 SV=1
Length = 280

Score = 37.7 bits (86), Expect = 0.29
Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 5/76 (6%)
Frame = +3

Query: 30 NYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSPCTLWEGLL 206
+YP T P P+KP Y+PPHT V K+PP PT + + P PS +
Sbjct: 186 HYPPHTPVYKSPPPPKKP--------YYPPHTPVYKSPPPPTPVYKSPPPSKKPYYPPHT 237

Query: 207 PL*IS----TPIYHVP 242
P+ S TP+Y P
Sbjct: 238 PVYKSPPPPTPVYKSP 253



Score = 37.0 bits (84), Expect = 0.49
Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
Frame = +3

Query: 66 PRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSPCTLWEGLLPL*ISTPIYHVP 242
P P S P+ Y+PPHT V K+PP PT + + P P TP+Y P
Sbjct: 218 PTPVYKSPPPSKKPYYPPHTPVYKSPPPPTPVYKSPPP--------------PTPVYKSP 263

Query: 243 ACGI*ALPPWHSHINA 290
PP H ++ A
Sbjct: 264 -------PPHHPYVYA 272



Score = 33.9 bits (76), Expect = 4.2
Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 4/43 (9%)
Frame = +3

Query: 60 HYPRPQKP---S*MPTSSKYWPPHT-VRKAPP*PTSLGELPSP 176
HYP P P S P + Y+PPHT V K+PP PT + + P P
Sbjct: 140 HYP-PHTPIYKSPPPPNKPYYPPHTPVYKSPPPPTPVYKSPPP 181


>tr|Q6K296|Q6K296_ORYSJ Putative uncharacterized protein B1080A02.29
(Putative uncharacterized protein P0574F11.6) OS=Oryza
sativa subsp. japonica GN=B1080A02.29 PE=4 SV=1
Length = 277

Score = 37.4 bits (85), Expect = 0.38
Identities = 21/52 (40%), Positives = 25/52 (48%)
Frame = +3

Query: 72 PQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCTLWEGLLPL*ISTP 227
P PS P SS P H R +PP P++ PSP+P L LP S P
Sbjct: 107 PTTPSTAPPSSNPTPTHKARPSPPPPSAATTNPSPNPSALARSPLPPSSSPP 158


>tr|Q9VZB2|Q9VZB2_DROME CG13722 OS=Drosophila melanogaster
GN=CG13722 PE=2 SV=1
Length = 707

Score = 36.6 bits (83), Expect = 0.65
Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
Frame = +3

Query: 63 YPRPQKPS*MPTS--SKYWPPHTVRKAPP*PTSLGELPSP 176
YP+P P PT+ KY PP T KAPP P ++ LP P
Sbjct: 324 YPKPAIPFPPPTAPPQKYLPPVTTTKAPPPPPTVKYLPPP 363


>tr|Q5CK29|Q5CK29_CRYHO Putative uncharacterized protein
OS=Cryptosporidium hominis GN=Chro.10057 PE=4 SV=1
Length = 966

Score = 36.6 bits (83), Expect = 0.65
Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)
Frame = +3

Query: 3 SPCHVITDENYP---LTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLG-ELP 170
SPC + E P LT+++ A P + P+ P + PP+ K+PP PT+ P
Sbjct: 146 SPCGGSSQEGIPSPRLTSNSEAGVPESKSPTSSPNPTTKSPPNPTTKSPPNPTTKSPPKP 205

Query: 171 SPSPCT 188
+P P T
Sbjct: 206 APKPTT 211


>tr|B4PI85|B4PI85_DROYA GE20610 OS=Drosophila yakuba GN=GE20610 PE=4
SV=1
Length = 657

Score = 36.6 bits (83), Expect = 0.65
Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
Frame = +3

Query: 63 YPRPQKPS*MPTS--SKYWPPHTVRKAPP*PTSLGELPSP 176
YP+P P PT+ KY PP T KAPP P ++ LP P
Sbjct: 322 YPKPAIPFPPPTAPPQKYLPPVTTTKAPPPPPTVKYLPPP 361


>tr|Q06802|Q06802_TOBAC Extensin OS=Nicotiana tabacum GN=HRGP PE=2
SV=1
Length = 318

Score = 35.8 bits (81), Expect = 1.1
Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 5/84 (5%)
Frame = +3

Query: 6 PCHVITDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSP 182
P H ++ P T P P+KP Y+PPHT V K+PP PT + + P P
Sbjct: 193 PPHTPVYKSPPPPTPVYKSPPPPKKP--------YYPPHTPVYKSPPPPTPVYKSPPPPK 244

Query: 183 CTLWEGLLPL*IS----TPIYHVP 242
+ P+ S TP+Y P
Sbjct: 245 KPYYPPYTPVYKSPPPPTPVYKSP 268



Score = 35.4 bits (80), Expect = 1.4
Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 5/75 (6%)
Frame = +3

Query: 33 YPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSPCTLWEGLLP 209
YP T P P+KP Y+PPHT V K+PP PT + + P P + P
Sbjct: 100 YPPHTPVYKSPPPPKKP--------YYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTP 151

Query: 210 L*IS----TPIYHVP 242
+ S TP+Y P
Sbjct: 152 VYKSPPPPTPVYKSP 166



Score = 35.4 bits (80), Expect = 1.4
Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 5/75 (6%)
Frame = +3

Query: 33 YPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSPCTLWEGLLP 209
YP T P P+KP Y+PPHT V K+PP PT + + P P + P
Sbjct: 174 YPPHTPVYKSPPPPKKP--------YYPPHTPVYKSPPPPTPVYKSPPPPKKPYYPPHTP 225

Query: 210 L*IS----TPIYHVP 242
+ S TP+Y P
Sbjct: 226 VYKSPPPPTPVYKSP 240



Score = 33.5 bits (75), Expect = 5.5
Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
Frame = +3

Query: 6 PCHVITDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSP 176
P H ++ P T P P+KP Y+PPHT V K+PP PT + + P P
Sbjct: 119 PPHTPVYKSPPPPTPVYKSPPPPKKP--------YYPPHTPVYKSPPPPTPVYKSPPP 168



Score = 33.5 bits (75), Expect = 5.5
Identities = 30/108 (27%), Positives = 44/108 (40%), Gaps = 13/108 (12%)
Frame = +3

Query: 6 PCHVITDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSP-- 176
P H ++ P T P P+KP Y+PP+T V K+PP PT + + P P
Sbjct: 221 PPHTPVYKSPPPPTPVYKSPPPPKKP--------YYPPYTPVYKSPPPPTPVYKSPPPPK 272

Query: 177 ----------SPCTLWEGLLPL*ISTPIYHVPACGI*ALPPWHSHINA 290
P +++ P TP+Y P PP H ++ A
Sbjct: 273 KPYYPSPTPYHPAPVYKSPPP---PTPVYKSP-------PPHHPYVYA 310



Score = 32.7 bits (73), Expect = 9.3
Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
Frame = +3

Query: 60 HYPRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSP 176
H+P + P P Y+PPHT V K+PP PT + + P P
Sbjct: 57 HHPVYKSPP--PPKKPYYPPHTPVYKSPPPPTPVYKSPPP 94


>tr|Q06446|Q06446_SOLTU Extensin OS=Solanum tuberosum PE=2 SV=1
Length = 291

Score = 35.8 bits (81), Expect = 1.1
Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 14/106 (13%)
Frame = +3

Query: 6 PCHVI-TDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHT-------------VRKAPP 143
P HV + ++P+ S H+ P S P+ ++PPHT V K+PP
Sbjct: 36 PVHVYPSPPHHPVYKSPPPHHHHPVYKSPPPSEKPHYPPHTPVYKSPPPHHHHPVYKSPP 95

Query: 144 *PTSLGELPSPSPCTLWEGLLPL*ISTPIYHVPACGI*ALPPWHSH 281
PT + + P P + TP+Y P PP H H
Sbjct: 96 PPTPVYKSPPPPKTPHYPP------HTPVYKSP-------PPHHHH 128



Score = 34.7 bits (78), Expect = 2.5
Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
Frame = +3

Query: 66 PRPQKPS*MPTSSKYWPPHT-VRKAPP*PTSLGELPSPSPCTLWEGLLPL*ISTPIYHVP 242
P P S P ++PPHT V K+PP PT + + P P P +++ P TP+Y P
Sbjct: 137 PTPVYKSPPPPKDPHYPPHTPVYKSPPPPTPVYKSP-PPPTPVYKSPPP---PTPVYKSP 192


>tr|B3NC50|B3NC50_DROER GG14181 OS=Drosophila erecta GN=GG14181 PE=4
SV=1
Length = 657

Score = 35.8 bits (81), Expect = 1.1
Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
Frame = +3

Query: 63 YPRPQKPS*MPTS--SKYWPPHTVRKAPP*PTSLGELPSP 176
YP+P P PT+ KY PP T KAPP P + LP P
Sbjct: 324 YPKPAIPFPPPTAPPQKYLPPVTTTKAPPPPPTAKYLPPP 363



Score = 34.3 bits (77), Expect = 3.2
Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 8/63 (12%)
Frame = +3

Query: 63 YPRPQKPS*MPTS--SKYWPPHTVRKAPP*PTSLG------ELPSPSPCTLWEGLLPL*I 218
YP+P P PT+ KY PP T +APP LG +P P P + LP
Sbjct: 141 YPKPAVPFPPPTAPPQKYLPPVTTTQAPPPQVKLGYDYPKPAIPFPPPTAPPQKYLPPVT 200

Query: 219 STP 227
+TP
Sbjct: 201 TTP 203



Score = 32.7 bits (73), Expect = 9.3
Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 2/40 (5%)
Frame = +3

Query: 63 YPRPQKPS*MPTS--SKYWPPHTVRKAPP*PTSLGELPSP 176
YP+P P PT+ KY PP T APP PTS LP P
Sbjct: 540 YPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPTS-KYLPPP 578


>tr|Q2RBH4|Q2RBH4_ORYSJ Transposon protein, putative, CACTA, En/Spm
sub-class, expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os11g02010 PE=4 SV=1
Length = 323

Score = 35.4 bits (80), Expect = 1.4
Identities = 24/69 (34%), Positives = 28/69 (40%)
Frame = +3

Query: 36 PLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSPCTLWEGLLPL* 215
P T IA PRP P+ P S PP + PP T+ PSP+P T P
Sbjct: 197 PPTPPTIARPPRPLPPASPPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASPTPPP 256

Query: 216 ISTPIYHVP 242
I T P
Sbjct: 257 IPTATVRPP 265


>tr|A5JVC8|A5JVC8_BRACM Putative uncharacterized protein OS=Brassica
campestris PE=4 SV=1
Length = 116

Score = 35.4 bits (80), Expect = 1.4
Identities = 20/55 (36%), Positives = 23/55 (41%)
Frame = +3

Query: 18 ITDENYPLTTSAIAHYPRPQKPS*MPTSSKYWPPHTVRKAPP*PTSLGELPSPSP 182
+ E+YP +HYP P PS P Y PPH PP P P P P
Sbjct: 6 VPPESYPPPPGYQSHYPPPGYPS-APPPPGYPPPHHEGYPPPQPHGYPPYPPPRP 59