BP920615
Clone id YMU001_000139_C09
Library
Length 608
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCACAGAGGCTCTTCACTGATAAGTTTATCTGGCATATCAGACTCATCCAGGATATCTTT
CATGTTATCGCCGTCAGCAGATGTATATGATGGGGTACTGTCCTCATCACTAAAATCAGC
ACCCTTATTGACATCAGGAGAAATATCCTCCTCAGAAGCTGCGGAGGTATGCATGACCAC
AGGTTCGGCAGGTTTTTCATCATCAGCTGCTGAGGTCTCCAGCAAATCACCAGTATCTCC
TGATTTGTCTGACGTCGAAACAGTGGAAGGGTTGTCATTAATACTAGACTCCTCAACTTG
TTCGTCTTCAGACCCCAGGTTTTGAACAGATGCAGGCTGAGCACCTTCATTTTTACTTTT
GTGTTGCTTTGTCTCCTCCACTGACCCTTCAGCATTACTTACTGAAGCTTCACTGTTCTC
CTTTAGGTCAACCTCTTGCGGTGTCTCTACAACATCAGTAGCCTTAGAAAAGGAGCCGGT
AGTTTTCTCCTCAGTTGCAGGCGGTGCTACTGTGACTTCTCTTGCTAAATCTCTTTTCAA
GTACAAGCTACGAGCTCCGAGCGCAAACNCAAGTGTCAACACGATCAAACCTCCAATTTT
CATCCACC
■■Homology search results ■■ -
sp_hit_id P21138
Definition sp|P21138|SERA_ENTHI Serine-rich 25 kDa antigen protein OS=Entamoeba histolytica
Align length 160
Score (bit) 50.1
E-value 9.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920615|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_C09.
(608 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P21138|SERA_ENTHI Serine-rich 25 kDa antigen protein OS=Entam... 50 9e-06
sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo sa... 50 1e-05
sp|Q9P785|YNY5_SCHPO LisH domain-containing protein C1711.05 OS=... 49 2e-05
sp|P32583|SRP40_YEAST Suppressor protein SRP40 OS=Saccharomyces ... 47 6e-05
sp|Q6FT26|DSE2_CANGA Protein DSE2 OS=Candida glabrata GN=DSE2 PE... 47 1e-04
sp|A2VD23|STM_DANRE Protein starmaker OS=Danio rerio GN=stm PE=2... 46 1e-04
sp|Q8NXJ1|CLFA_STAAW Clumping factor A OS=Staphylococcus aureus ... 46 1e-04
sp|Q6GB45|CLFA_STAAS Clumping factor A OS=Staphylococcus aureus ... 46 1e-04
sp|Q5ZMU6|PP4R2_CHICK Serine/threonine-protein phosphatase 4 reg... 46 2e-04
sp|Q99VJ4|CLFA_STAAN Clumping factor A OS=Staphylococcus aureus ... 46 2e-04
sp|Q932C5|CLFA_STAAM Clumping factor A OS=Staphylococcus aureus ... 46 2e-04
sp|Q1LY77|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-... 45 2e-04
sp|P97399|DSPP_MOUSE Dentin sialophosphoprotein OS=Mus musculus ... 45 4e-04
sp|Q6AWX6|SCAR1_ARATH Protein SCAR1 OS=Arabidopsis thaliana GN=S... 44 6e-04
sp|Q9W596|FUTSC_DROME Microtubule-associated protein futsch OS=D... 44 6e-04
sp|Q62598|DSPP_RAT Dentin sialophosphoprotein OS=Rattus norvegic... 44 6e-04
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p1... 44 8e-04
sp|O94488|MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosa... 43 0.001
sp|Q53653|CLFA_STAAE Clumping factor A OS=Staphylococcus aureus ... 42 0.002
sp|Q5HHM8|CLFA_STAAC Clumping factor A OS=Staphylococcus aureus ... 42 0.002
sp|Q2G015|CLFA_STAA8 Clumping factor A OS=Staphylococcus aureus ... 42 0.002
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis GN=SW... 42 0.002
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus muscu... 42 0.002
sp|Q03661|ESC1_YEAST Silent chromatin protein ESC1 OS=Saccharomy... 41 0.004
sp|Q6GDH2|CLFB_STAAR Clumping factor B OS=Staphylococcus aureus ... 41 0.005
sp|Q4L9P0|SRAP_STAHJ Serine-rich adhesin for platelets OS=Staphy... 40 0.007
sp|P12348|PER_DROPS Period circadian protein OS=Drosophila pseud... 40 0.007
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe G... 40 0.007
sp|Q4V886|PAF1_RAT RNA polymerase II-associated factor 1 homolog... 40 0.009
sp|P45384|IGA2_HAEIN Immunoglobulin A1 protease OS=Haemophilus i... 40 0.009

>sp|P21138|SERA_ENTHI Serine-rich 25 kDa antigen protein
OS=Entamoeba histolytica PE=1 SV=1
Length = 233

Score = 50.1 bits (118), Expect = 9e-06
Identities = 52/160 (32%), Positives = 77/160 (48%), Gaps = 11/160 (6%)
Frame = -3

Query: 474 SFSKATDVV-ETPQEVDLKENSEASVSNAEGSVE--ETKQHKSKNEGAQPASVQNLGSED 304
+F+ AT+++ + QEV + N E S E E + K K+ A+P S N +ED
Sbjct: 9 AFTSATNIILDLDQEVKDTNIYGVFLKN-EASPEKLEEAEEKEKSSSAKPESSSNEDNED 67

Query: 303 EQVEESSINDNPSTVSTSDK-----SGDTGDLLETSAAD--DEKPAEPVVMHTSAASEED 145
++ E++S +DN S S+SDK + D E S++D D KP AS D
Sbjct: 68 DEDEKASSSDN-SESSSSDKPDNKPEASSSDKPEASSSDKPDNKP---------EASSSD 117

Query: 144 ISPDVNKGADFSDE-DSTPSYTSADGDNMKDILDESDMPD 28
PD A SD+ D+ P +S+D + K SD PD
Sbjct: 118 -KPDNKPEASSSDKPDNKPEASSSDKPDNKPEASSSDKPD 156


>sp|Q96QF7|ACRC_HUMAN Acidic repeat-containing protein OS=Homo
sapiens GN=ACRC PE=2 SV=1
Length = 691

Score = 49.7 bits (117), Expect = 1e-05
Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 4/151 (2%)
Frame = -3

Query: 468 SKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKS-KNEGAQPASVQNLGSEDEQVE 292
S+A D +V + ++S N++ S ++ ++ + + V + S+D V
Sbjct: 176 SEAPDDNSDDSDVPDDNSDDSSDDNSDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVP 235

Query: 291 ESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEE---DISPDVNKG 121
+ S +D+ + +SD S D + S A D+ + S+ E D S D
Sbjct: 236 DDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEASDDSSDDSEAS 295

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESDMPD 28
D SD+ P S D D +D D+SD+PD
Sbjct: 296 DDSSDDSEAPDDKSDDSDVPEDKSDDSDVPD 326



Score = 43.1 bits (100), Expect = 0.001
Identities = 36/136 (26%), Positives = 54/136 (39%), Gaps = 4/136 (2%)
Frame = -3

Query: 423 KENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVE----ESSINDNPSTVS 256
K + + V S EE H+ K A + + S+DE E + +I + P +S
Sbjct: 70 KRQASSVVVIDSDSDEECHTHEEKK-----AKLLEINSDDESPECCHVKPAIQEPPIVIS 124

Query: 255 TSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSA 76
D D G+ LE + + P +D S D D SD+ P S
Sbjct: 125 DDDNDDDNGNDLEVPDDNSDDSEAP----------DDNSDDSEAPDDNSDDSEAPDDNSD 174

Query: 75 DGDNMKDILDESDMPD 28
D + D D+SD+PD
Sbjct: 175 DSEAPDDNSDDSDVPD 190



Score = 40.0 bits (92), Expect = 0.009
Identities = 38/153 (24%), Positives = 67/153 (43%), Gaps = 7/153 (4%)
Frame = -3

Query: 468 SKATDVVETPQEVDLKENSE-ASVSNAEGS-VEETKQHKSK--NEGAQPASVQNLGSEDE 301
S +DV + + +NS+ +S N++ S V + K S ++ + + V + S+D
Sbjct: 183 SDDSDVPDDNSDDSSDDNSDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDS 242

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEE---DISPDV 130
+ + S +D+ + +SD S D + S A D+ + S+ E D S D
Sbjct: 243 EAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEASDDSSDDSEASDDSSDDS 302

Query: 129 NKGADFSDEDSTPSYTSADGDNMKDILDESDMP 31
D SD+ P S D D D D+ ++P
Sbjct: 303 EAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVP 335



Score = 35.8 bits (81), Expect = 0.18
Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 4/112 (3%)
Frame = -3

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
++ V + S+D + + + +D+ + SD S D + S A D+ + V
Sbjct: 130 DDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVP 189

Query: 171 HTSAASEEDISPDVNKGADFSDEDS----TPSYTSADGDNMKDILDESDMPD 28
++ D + D D SD++S P S D D D D+SD+PD
Sbjct: 190 DDNSDDSSDDNSD-----DSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPD 236


>sp|Q9P785|YNY5_SCHPO LisH domain-containing protein C1711.05
OS=Schizosaccharomyces pombe GN=SPBC1711.05 PE=2 SV=1
Length = 451

Score = 48.9 bits (115), Expect = 2e-05
Identities = 47/178 (26%), Positives = 78/178 (43%), Gaps = 17/178 (9%)
Frame = -3

Query: 507 APP-----ATEEKTTGSFSKATDVVETPQEVDLKEN---SEASVSNAEGSVEETKQHKSK 352
APP ++E +GS S +D + E ++N S +S S +E S E++ S
Sbjct: 91 APPEKAHSSSEASGSGSSSDESDSSSSESESSSEDNDSSSSSSDSESESSSEDSDSSSSS 150

Query: 351 NEGAQPASVQ---NLGSEDEQVEESSINDNPSTVSTSD-----KSGDTGDLLETSAADDE 196
++ +S + + S ESS DN S+ S+SD S D+ +S ++ E
Sbjct: 151 SDSESESSSEGSDSSSSSSSSESESSSEDNDSSSSSSDSESESSSEDSDSSSSSSDSESE 210

Query: 195 KPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILD-ESDMPDK 25
+E +S++S E S + + S DS +S D D+ D ES+ K
Sbjct: 211 SSSEGSDSSSSSSSSESESSSEDNDSSSSSSDSESESSSEDSDSSSSSSDSESESSSK 268



Score = 46.6 bits (109), Expect = 1e-04
Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 3/166 (1%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSE--ASVSNAEGSVEETKQHKSKNEGAQPASV 325
++E+ + S S ++ + ++ D +S S S++EGS + S++E + +
Sbjct: 176 SSEDNDSSSSSSDSESESSSEDSDSSSSSSDSESESSSEGSDSSSSSSSSESESSSEDND 235

Query: 324 QNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEED 145
+ S D + E SS D+ S+ S+SD E+S+ D + + S+ SE+D
Sbjct: 236 SSSSSSDSESESSS-EDSDSSSSSSDSES------ESSSKDSDSSSN------SSDSEDD 282

Query: 144 ISPDVNKG-ADFSDEDSTPSYTSADGDNMKDILDESDMPDKLISEE 10
S D + ++ S EDS + +S+D D+ D + D S E
Sbjct: 283 SSSDSSDSESESSSEDSDSTSSSSDSDSSSSSEDGNSNTDTTTSGE 328



Score = 42.4 bits (98), Expect = 0.002
Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 5/167 (2%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
DL + P T E G K + +E K N ++ + +G+ E S+
Sbjct: 50 DLLSQKEFLPYLTTEDV-GKHKKTKESLE-------KSNDDSQKISKKGAPPEKAHSSSE 101

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSD-----KSGDTGDLLETSAADDEKPA 187
G+ +S ++ S E ESS DN S+ S+SD S D+ +S ++ E +
Sbjct: 102 ASGSGSSSDESDSSSSES--ESSSEDNDSSSSSSDSESESSSEDSDSSSSSSDSESESSS 159

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILD 46
E +S++S E S + + S DS +S D D+ D
Sbjct: 160 EGSDSSSSSSSSESESSSEDNDSSSSSSDSESESSSEDSDSSSSSSD 206


>sp|P32583|SRP40_YEAST Suppressor protein SRP40 OS=Saccharomyces
cerevisiae GN=SRP40 PE=1 SV=2
Length = 406

Score = 47.4 bits (111), Expect = 6e-05
Identities = 36/149 (24%), Positives = 67/149 (44%)
Frame = -3

Query: 483 TTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSED 304
++ S S ++D + E + + A S+ E + +ETK+ K++ E + + + GS
Sbjct: 105 SSSSSSSSSDESSSESESEDETKKRARESDNEDA-KETKKAKTEPESSSSSESSSSGSSS 163

Query: 303 EQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNK 124
ES + + S+S S D S +D E ++ +S+ S D +
Sbjct: 164 SSESESGSESDSDSSSSSSSSSD-------SESDSESDSQSSSSSSSSDSSSDSDSSSSD 216

Query: 123 GADFSDEDSTPSYTSADGDNMKDILDESD 37
+ SD S+ S +S+D D+ D +SD
Sbjct: 217 SSSDSDSSSSSSSSSSDSDSDSDSSSDSD 245



Score = 43.9 bits (102), Expect = 6e-04
Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 10/166 (6%)
Frame = -3

Query: 492 EEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLG 313
E K S D ET + E+S +S S++ GS ++ + +S +
Sbjct: 125 ETKKRARESDNEDAKETKKAKTEPESSSSSESSSSGSSSSSESESGSESDSDSSSSSSSS 184

Query: 312 SEDEQVEES--------SIND--NPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTS 163
S+ E ES S +D + S S+SD S D+ +S++ + ++ +S
Sbjct: 185 SDSESDSESDSQSSSSSSSSDSSSDSDSSSSDSSSDSDSSSSSSSSSSDSDSD---SDSS 241

Query: 162 AASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDK 25
+ S+ S D + +D S ++ST S S+D D+ D S++ K
Sbjct: 242 SDSDSSGSSDSSSSSDSSSDESTSS-DSSDSDSDSDSGSSSELETK 286



Score = 43.5 bits (101), Expect = 8e-04
Identities = 31/133 (23%), Positives = 57/133 (42%)
Frame = -3

Query: 426 LKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSD 247
+K + +S E +EE S + + +S + S ESS + + S+ S+S
Sbjct: 6 IKVDEVPKLSVKEKEIEEKSSSSSSSSSSSSSSSSSSSSSSSSSGESSSSSSSSSSSSSS 65

Query: 246 KSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGD 67
S D+ D +S++ + + ++SE D S + + S D + S + ++ D
Sbjct: 66 DSSDSSDSESSSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSESESE-D 124

Query: 66 NMKDILDESDMPD 28
K ESD D
Sbjct: 125 ETKKRARESDNED 137



Score = 42.4 bits (98), Expect = 0.002
Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 12/169 (7%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEG--------SVEETKQHKSKNEG 343
++ ++ S S ++ E+ E D + +S S++ S +ETK+ +++
Sbjct: 76 SSSSSSSSSSSSSSSDSESSSESDSSSSGSSSSSSSSSDESSSESESEDETKKRARESDN 135

Query: 342 AQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDL----LETSAADDEKPAEPVV 175
+ +E E S + + S+ S+ +SG D +S++D E +E
Sbjct: 136 EDAKETKKAKTEPESSSSSESSSSGSSSSSESESGSESDSDSSSSSSSSSDSESDSESDS 195

Query: 174 MHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPD 28
+S++S D S SD DS+ S +S+D D+ S D
Sbjct: 196 QSSSSSSSSDSS---------SDSDSSSSDSSSDSDSSSSSSSSSSDSD 235


>sp|Q6FT26|DSE2_CANGA Protein DSE2 OS=Candida glabrata GN=DSE2 PE=3
SV=1
Length = 294

Score = 46.6 bits (109), Expect = 1e-04
Identities = 40/162 (24%), Positives = 70/162 (43%), Gaps = 2/162 (1%)
Frame = -3

Query: 543 YLKRDLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASV--SNAEGSVEET 370
Y + RE+T+A +V T +E+ S ASV S + SV ET
Sbjct: 64 YYTTTIVREITLAN--------------NEVTTTTEEITSASVSSASVTPSASSSSVSET 109

Query: 369 KQHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKP 190
KS++ + +S+ + E+ ++ + S DN S+ +S S + + ++++
Sbjct: 110 TTSKSESAASVSSSISSNNDEESEIPDQSFLDNDSSSVSSYISSMSPETSSSTSSSS--- 166

Query: 189 AEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDN 64
MH S S S N G+DFS S+ S +S+ +
Sbjct: 167 ----TMHNSTVSSFMPSSVDNSGSDFSSSSSSSSSSSSSSSS 204



Score = 31.6 bits (70), Expect = 3.3
Identities = 32/151 (21%), Positives = 55/151 (36%), Gaps = 9/151 (5%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE---------ETK 367
E T + + + S S D + +N +SVS+ S+ +
Sbjct: 108 ETTTSKSESAASVSSSISSNNDEESEIPDQSFLDNDSSSVSSYISSMSPETSSSTSSSST 167

Query: 366 QHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPA 187
H S P+SV N GS+ SS + + S+ S+S S + + + + +
Sbjct: 168 MHNSTVSSFMPSSVDNSGSD---FSSSSSSSSSSSSSSSSSSRSSSSMSSSISMPISSSS 224

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDST 94
+ S++S D NK S D T
Sbjct: 225 SSSISSCSSSSSFDFD---NKSYSISKSDGT 252


>sp|A2VD23|STM_DANRE Protein starmaker OS=Danio rerio GN=stm PE=2
SV=1
Length = 613

Score = 46.2 bits (108), Expect = 1e-04
Identities = 47/187 (25%), Positives = 81/187 (43%), Gaps = 29/187 (15%)
Frame = -3

Query: 501 PATEEKTTGSFS--KATDVVETPQEVDLKE--NSEASVSNAEGSVEETKQHKSKNEGAQP 334
P+ E+ T G+ + +TD E+P D E +S+++ S E+T S +E A
Sbjct: 163 PSAEDHTDGNHAGKDSTDSKESPDTTDKPEGPDSDSAPDGDSASAEKTDSDHSPDEDANK 222

Query: 333 ASVQ--------------------NLGSEDEQVEESS--INDNPSTVSTSDKSGDTGDLL 220
+S + + +DE+ E+ ++ S+ + DKS + D
Sbjct: 223 SSTEADKDDTSDKDSSQTDEKHDSDASDKDEKHEDKDEKSDEKDSSKDSEDKSQEKSDKS 282

Query: 219 E---TSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDIL 49
+ S AD++K + H S + + D S + + D D+DS+ S S D D KD
Sbjct: 283 DDGSNSEADEQKESVESKDHDSDSQDSD-SAEKKEKHDDKDQDSSDSADSKDSDEDKD-K 340

Query: 48 DESDMPD 28
D S+ D
Sbjct: 341 DHSEQKD 347



Score = 43.1 bits (100), Expect = 0.001
Identities = 43/179 (24%), Positives = 76/179 (42%), Gaps = 16/179 (8%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDL-----KENSEASVSNAEGSVEETKQHKSKNEGAQP 334
A+ EKT S D ++ E D K++S+ + + ++ ++H+ K+E +
Sbjct: 205 ASAEKTDSDHSPDEDANKSSTEADKDDTSDKDSSQTDEKHDSDASDKDEKHEDKDEKSDE 264

Query: 333 ASVQNLGSEDEQVEESSINDNPS---------TVSTSDKSGDT--GDLLETSAADDEKPA 187
+ SED+ E+S +D+ S +V + D D+ D E D+K
Sbjct: 265 KD-SSKDSEDKSQEKSDKSDDGSNSEADEQKESVESKDHDSDSQDSDSAEKKEKHDDKDQ 323

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDKLISEE 10
+ S S+ED D ++ D D + +T D + KD + D DK S+E
Sbjct: 324 DSSDSADSKDSDEDKDKDHSEQKDSEDHEHKEKHTK-DKEEHKDSDEGKDDEDKSKSDE 381



Score = 37.0 bits (84), Expect = 0.079
Identities = 32/167 (19%), Positives = 66/167 (39%), Gaps = 13/167 (7%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE------------ETKQHKS 355
+ E K S S+ +D E ++ D K+ + ++++ S E E +HK
Sbjct: 296 SVESKDHDSDSQDSDSAEKKEKHDDKDQDSSDSADSKDSDEDKDKDHSEQKDSEDHEHKE 355

Query: 354 KN-EGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPV 178
K+ + + + G +DE +S +D + S D + E +
Sbjct: 356 KHTKDKEEHKDSDEGKDDEDKSKSDEHDKDESESKEASKSDESEQEEKKDDKSDSDNSSR 415

Query: 177 VMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
H+ + S+ D + +D + + S++ +D D+ D +SD
Sbjct: 416 DSHSDSDSDSHSDSDSDSHSDSHSDSDSDSHSDSDSDSDSDSDSDSD 462



Score = 36.6 bits (83), Expect = 0.10
Identities = 38/184 (20%), Positives = 66/184 (35%), Gaps = 24/184 (13%)
Frame = -3

Query: 492 EEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE----------- 346
+EK ++D ++ + K+ + ++E + K K K E
Sbjct: 315 KEKHDDKDQDSSDSADSKDSDEDKDKDHSEQKDSEDHEHKEKHTKDKEEHKDSDEGKDDE 374

Query: 345 -------------GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAA 205
++ AS + ++E+ ++ S +DN S S SD D+ ++ +
Sbjct: 375 DKSKSDEHDKDESESKEASKSDESEQEEKKDDKSDSDNSSRDSHSDSDSDSHSDSDSDSH 434

Query: 204 DDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDK 25
D H+ + S+ D D SD DS S D D KD ES D
Sbjct: 435 SDSHSDSDSDSHSDSDSDSDSDSD-------SDSDSDSDSNSRDKDEKKDKSSESRDEDS 487

Query: 24 LISE 13
S+
Sbjct: 488 SDSD 491



Score = 32.7 bits (73), Expect = 1.5
Identities = 36/147 (24%), Positives = 57/147 (38%), Gaps = 2/147 (1%)
Frame = -3

Query: 462 ATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNL--GSEDEQVEE 289
++D E P D K+++E +G +E +QH +G A + G+ D+ +
Sbjct: 76 SSDTTEKPGTTDGKDSAEQHGVTTDGK-DEAEQHGVTTDGQDSAEKRGEADGAPDKPDTQ 134

Query: 288 SSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFS 109
+ +D S T TGD DE +P S ED + + G
Sbjct: 135 NGTDDTDSDQETDASHHKTGD-------SDENKDKP--------SAEDHTDGNHAG---- 175

Query: 108 DEDSTPSYTSADGDNMKDILDESDMPD 28
+DST S S D + + D PD
Sbjct: 176 -KDSTDSKESPDTTDKPEGPDSDSAPD 201



Score = 31.2 bits (69), Expect = 4.3
Identities = 34/167 (20%), Positives = 66/167 (39%), Gaps = 11/167 (6%)
Frame = -3

Query: 495 TEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNL 316
++ + S S + + + D +S + + S ++ + + S N
Sbjct: 410 SDNSSRDSHSDSDSDSHSDSDSDSHSDSHSDSDSDSHSDSDSDSDSDSDSDSDSDSDSNS 469

Query: 315 GSEDEQVEESSIN-DNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
+DE+ ++SS + D S+ S S + ++ + E DD+ + V S + S
Sbjct: 470 RDKDEKKDKSSESRDEDSSDSDSKSNSESSETAEEDTNDDKDSS---VEKDKTDSSDSAS 526

Query: 138 PDVNKGADFSDE---DSTPS-------YTSADGDNMKDILDESDMPD 28
+ N D D+ D+TPS T D ++ D D+ D D
Sbjct: 527 VEANDSDDEHDDDSKDATPSSEDHTAEKTDEDSHDVSDDDDDIDAHD 573


>sp|Q8NXJ1|CLFA_STAAW Clumping factor A OS=Staphylococcus aureus
(strain MW2) GN=clfA PE=3 SV=1
Length = 946

Score = 46.2 bits (108), Expect = 1e-04
Identities = 26/140 (18%), Positives = 59/140 (42%)
Frame = -3

Query: 456 DVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSIN 277
++ P++ D S++ + S ++ + + G+ AS + S+ + +S
Sbjct: 552 EIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSA 611

Query: 276 DNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDS 97
+ + S SD + D+ ++ +A D A + S+ D D + +D +
Sbjct: 612 SDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSD 671

Query: 96 TPSYTSADGDNMKDILDESD 37
+ S + +D D+ D +SD
Sbjct: 672 SDSDSDSDSDSDSDSDSDSD 691



Score = 42.4 bits (98), Expect = 0.002
Identities = 25/119 (21%), Positives = 52/119 (43%), Gaps = 2/119 (1%)
Frame = -3

Query: 387 GSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSA 208
G +E + + G+ S N S + +S+ + + S SD + D+ ++ +
Sbjct: 551 GEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDS 610

Query: 207 ADDEKPA--EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
A D A + +AS+ D + D + +D ++ + S + +D D+ D +SD
Sbjct: 611 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSD 669



Score = 37.7 bits (86), Expect = 0.046
Identities = 25/148 (16%), Positives = 61/148 (41%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + D +S+++ + S ++ + AS + S+ +
Sbjct: 580 SGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 639

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S +++ + S SD D+ ++ + D + + S+ D D +
Sbjct: 640 SASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 699

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 700 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 727



Score = 36.6 bits (83), Expect = 0.10
Identities = 25/151 (16%), Positives = 61/151 (40%)
Frame = -3

Query: 489 EKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGS 310
+ T+ S S + ++ + D +S+++ + S ++ + AS + S
Sbjct: 583 DSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSAS 642

Query: 309 EDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDV 130
+ + +S + + + S SD D+ ++ + D + + S+ D D
Sbjct: 643 DSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 702

Query: 129 NKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ +D + + S + +D D+ D +SD
Sbjct: 703 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 733



Score = 36.2 bits (82), Expect = 0.13
Identities = 22/137 (16%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S+++ + S ++ + + S + S+ + +S + +
Sbjct: 735 DSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDS 794

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + ++ S
Sbjct: 795 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSASDS 854

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 855 DSGSDSDSSSDSDSESD 871



Score = 35.8 bits (81), Expect = 0.18
Identities = 24/154 (15%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+T + + S S + ++ D S++ ++ S ++ + + S +
Sbjct: 584 STSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASD 643

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+++ +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 644 SDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 703

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 704 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 737



Score = 35.8 bits (81), Expect = 0.18
Identities = 27/165 (16%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ + D +S++ + S ++
Sbjct: 615 DSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDS 674

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 734

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D N +D + + S + +D D+ D +SD
Sbjct: 735 DSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 779



Score = 35.0 bits (79), Expect = 0.30
Identities = 23/137 (16%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + N
Sbjct: 691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNS 750

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D +++ S+ D D + +D + + S
Sbjct: 751 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDS 810

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 811 DSDSDSDSDSDSDSESD 827



Score = 34.3 bits (77), Expect = 0.51
Identities = 24/148 (16%), Positives = 57/148 (38%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + S+++ + S ++ + AS + S+ +
Sbjct: 568 SGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 627

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + S SD D+ ++ + D + + S+ D D +
Sbjct: 628 SASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 687

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 688 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 715



Score = 34.3 bits (77), Expect = 0.51
Identities = 22/137 (16%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 711 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 770

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D E + S
Sbjct: 771 DSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDS 830

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 831 ESDSDSDSDSDSDSDSD 847



Score = 33.9 bits (76), Expect = 0.67
Identities = 23/154 (14%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S+++ + S ++ + + S +
Sbjct: 604 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSD 663

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 664 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 723

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 724 SDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSD 757



Score = 33.9 bits (76), Expect = 0.67
Identities = 26/137 (18%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S N S+ + +S + +
Sbjct: 707 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDS 766

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ D SA+D + ++ S+ D D + +D + + S
Sbjct: 767 DSDSDSDSDSDS-DSDSDSASDSDSDSD---------SDSDSDSDSDSDSDSDSDSDSDS 816

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 817 DSDSDSDSESDSDSESD 833



Score = 33.5 bits (75), Expect = 0.87
Identities = 27/165 (16%), Positives = 61/165 (36%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ N S ++
Sbjct: 603 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDS 662

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 663 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 722

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 723 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSD 767



Score = 33.5 bits (75), Expect = 0.87
Identities = 22/137 (16%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S N +
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDS 752

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 753 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDS 812

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 813 DSDSDSDSDSDSESDSD 829



Score = 33.1 bits (74), Expect = 1.1
Identities = 21/137 (15%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 657 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 716

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D ++ + S+ D D + +D + + S
Sbjct: 717 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDS 776

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 777 DSDSDSDSASDSDSDSD 793



Score = 32.7 bits (73), Expect = 1.5
Identities = 23/148 (15%), Positives = 59/148 (39%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+ S S + ++ + D +S+++ + S ++ + AS + ++ +
Sbjct: 592 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSD 651

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + + S SD D+ ++ + D + + S+ D D +
Sbjct: 652 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 711

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 712 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 739



Score = 32.7 bits (73), Expect = 1.5
Identities = 29/158 (18%), Positives = 61/158 (38%), Gaps = 4/158 (2%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S++ + S N+ + +
Sbjct: 599 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDS 658

Query: 318 LGSEDEQVEESSINDNPS---TVSTSDKSGDT-GDLLETSAADDEKPAEPVVMHTSAASE 151
D + S +D+ S + S SD D+ D S +D + ++ + + S+
Sbjct: 659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD---SDSDSDSD 715

Query: 150 EDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D D + +D + + S + +D D+ D +SD
Sbjct: 716 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSD 753



Score = 32.7 bits (73), Expect = 1.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 653 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 712

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 713 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDS 772

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 773 DSDSDSDSDSDSASDSD 789



Score = 32.3 bits (72), Expect = 1.9
Identities = 28/155 (18%), Positives = 59/155 (38%), Gaps = 1/155 (0%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S++ + S ++ A + N
Sbjct: 593 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSA----SDSDSASDSDSDN 648

Query: 318 LGSEDEQVEESSINDNPS-TVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDI 142
D + S +D+ S + S SD D+ ++ + D + + S+ D
Sbjct: 649 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 708

Query: 141 SPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 709 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 743



Score = 32.3 bits (72), Expect = 1.9
Identities = 25/165 (15%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D ++++ + S ++
Sbjct: 609 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDS 668

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 728

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + + S + +D D+ D +SD
Sbjct: 729 DSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSD 773



Score = 32.3 bits (72), Expect = 1.9
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 665 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 724

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 725 DSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 784

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 785 ASDSDSDSDSDSDSDSD 801



Score = 32.3 bits (72), Expect = 1.9
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 677 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 736

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 737 DSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDS 796

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 797 DSDSDSDSDSDSDSDSD 813



Score = 32.0 bits (71), Expect = 2.5
Identities = 23/151 (15%), Positives = 59/151 (39%)
Frame = -3

Query: 489 EKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGS 310
+ + S S + + + D +S++ + S ++ + + S + S
Sbjct: 633 DSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 692

Query: 309 EDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDV 130
+ + +S + + + S SD D+ ++ + D + + S+ D + D
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDS 752

Query: 129 NKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ +D + + S + +D D+ D +SD
Sbjct: 753 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 783



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 663 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 722

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 723 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 782

Query: 87 YTSADGDNMKDILDESD 37
+++D D+ D +SD
Sbjct: 783 DSASDSDSDSDSDSDSD 799



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 728

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + ++ S
Sbjct: 729 DSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDS 788

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 789 DSDSDSDSDSDSDSDSD 805



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 713 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDS 772

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 773 DSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSES 832

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 833 DSDSDSDSDSDSDSDSD 849



Score = 32.0 bits (71), Expect = 2.5
Identities = 23/137 (16%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 723 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 782

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ D S +D + ++ + + S+ D D +D + + S
Sbjct: 783 DSASDSDSDSDS-DSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSESDSDSESDSDSDS 838

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 839 DSDSDSDSDSDSASDSD 855



Score = 31.2 bits (69), Expect = 4.3
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 673 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 732

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ + + D + + S+ D D + +D + + + S
Sbjct: 733 DSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDS 792

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 793 DSDSDSDSDSDSDSDSD 809



Score = 31.2 bits (69), Expect = 4.3
Identities = 23/137 (16%), Positives = 57/137 (41%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 709 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDS 768

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ SA+D + ++ + + S+ D D + +D + + S
Sbjct: 769 DSDSDSDSDSDSD---SDSASDSDSDSD---SDSDSDSDSDSDSDSDSDSDSDSDSDSDS 822

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 823 DSESDSDSESDSDSDSD 839



Score = 30.8 bits (68), Expect = 5.6
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 671 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 730

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++++ D + + S+ D D + +D + S
Sbjct: 731 DSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDS 790

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 791 DSDSDSDSDSDSDSDSD 807



Score = 30.4 bits (67), Expect = 7.4
Identities = 23/138 (16%), Positives = 58/138 (42%), Gaps = 1/138 (0%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 744

Query: 267 STVSTSDKSGDT-GDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTP 91
+ S SD D+ D S +D + ++ + + S+ D + D + +D + +
Sbjct: 745 DSDSNSDSDSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSASDSDSDSDSDSDSDSD 801

Query: 90 SYTSADGDNMKDILDESD 37
S + +D D+ D +SD
Sbjct: 802 SDSDSDSDSDSDSDSDSD 819


>sp|Q6GB45|CLFA_STAAS Clumping factor A OS=Staphylococcus aureus
(strain MSSA476) GN=clfA PE=3 SV=1
Length = 928

Score = 46.2 bits (108), Expect = 1e-04
Identities = 26/140 (18%), Positives = 59/140 (42%)
Frame = -3

Query: 456 DVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSIN 277
++ P++ D S++ + S ++ + + G+ AS + S+ + +S
Sbjct: 552 EIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSA 611

Query: 276 DNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDS 97
+ + S SD + D+ ++ +A D A + S+ D D + +D +
Sbjct: 612 SDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSD 671

Query: 96 TPSYTSADGDNMKDILDESD 37
+ S + +D D+ D +SD
Sbjct: 672 SDSDSDSDSDSDSDSDSDSD 691



Score = 42.4 bits (98), Expect = 0.002
Identities = 25/119 (21%), Positives = 52/119 (43%), Gaps = 2/119 (1%)
Frame = -3

Query: 387 GSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSA 208
G +E + + G+ S N S + +S+ + + S SD + D+ ++ +
Sbjct: 551 GEIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDS 610

Query: 207 ADDEKPA--EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
A D A + +AS+ D + D + +D ++ + S + +D D+ D +SD
Sbjct: 611 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSD 669



Score = 37.7 bits (86), Expect = 0.046
Identities = 25/148 (16%), Positives = 61/148 (41%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + D +S+++ + S ++ + AS + S+ +
Sbjct: 580 SGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 639

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S +++ + S SD D+ ++ + D + + S+ D D +
Sbjct: 640 SASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 699

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 700 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 727



Score = 36.2 bits (82), Expect = 0.13
Identities = 22/137 (16%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S+++ + S ++ + + S + S+ + +S + +
Sbjct: 717 DSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDS 776

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + ++ S
Sbjct: 777 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSASDS 836

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 837 DSGSDSDSSSDSDSESD 853



Score = 35.8 bits (81), Expect = 0.18
Identities = 27/154 (17%), Positives = 58/154 (37%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S++ + S N+ + +
Sbjct: 599 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDS 658

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
D + S +D+ S S SD D+ ++ + D + + S+ D
Sbjct: 659 DSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 717

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + ++ S + +D D+ D +SD
Sbjct: 718 SDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSD 751



Score = 35.0 bits (79), Expect = 0.30
Identities = 23/137 (16%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + N
Sbjct: 673 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNS 732

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D +++ S+ D D + +D + + S
Sbjct: 733 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDS 792

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 793 DSDSDSDSDSDSDSESD 809



Score = 34.3 bits (77), Expect = 0.51
Identities = 24/148 (16%), Positives = 57/148 (38%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + S+++ + S ++ + AS + S+ +
Sbjct: 568 SGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 627

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + S SD D+ ++ + D + + S+ D D +
Sbjct: 628 SASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 687

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 688 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 715



Score = 34.3 bits (77), Expect = 0.51
Identities = 26/155 (16%), Positives = 64/155 (41%), Gaps = 1/155 (0%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+T + + S S + ++ D S++ ++ S ++ + + S +
Sbjct: 584 STSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASD 643

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDT-GDLLETSAADDEKPAEPVVMHTSAASEEDI 142
S+++ +S + + + S SD D+ D S +D + ++ + + S+ D
Sbjct: 644 SDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDS 700

Query: 141 SPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSD 735



Score = 34.3 bits (77), Expect = 0.51
Identities = 26/154 (16%), Positives = 57/154 (37%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S+++ + S ++ + +
Sbjct: 611 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDS 670

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
D + S +D+ S SD D+ ++ + D + + S+ D
Sbjct: 671 DSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 727

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D N +D + + S + +D D+ D +SD
Sbjct: 728 SDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 761



Score = 34.3 bits (77), Expect = 0.51
Identities = 23/154 (14%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S++ + S ++ + + S +
Sbjct: 622 SASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 681

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D ++ + S+ D
Sbjct: 682 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSD 741

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 742 SDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSD 775



Score = 34.3 bits (77), Expect = 0.51
Identities = 22/137 (16%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 752

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D E + S
Sbjct: 753 DSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDS 812

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 813 ESDSDSDSDSDSDSDSD 829



Score = 33.9 bits (76), Expect = 0.67
Identities = 26/137 (18%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S N S+ + +S + +
Sbjct: 689 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDS 748

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ D SA+D + ++ S+ D D + +D + + S
Sbjct: 749 DSDSDSDSDSDS-DSDSDSASDSDSDSD---------SDSDSDSDSDSDSDSDSDSDSDS 798

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 799 DSDSDSDSESDSDSESD 815



Score = 33.5 bits (75), Expect = 0.87
Identities = 22/137 (16%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S N +
Sbjct: 675 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDS 734

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 735 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDS 794

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 795 DSDSDSDSDSDSESDSD 811



Score = 33.1 bits (74), Expect = 1.1
Identities = 23/148 (15%), Positives = 59/148 (39%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+ S S + ++ + D +S+++ + S ++ + AS + ++ +
Sbjct: 592 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSD 651

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + + S SD D+ ++ + D + + S+ D D +
Sbjct: 652 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 711

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 712 SDSDSDSDSDSDSDSDSDSNSDSDSDSD 739



Score = 33.1 bits (74), Expect = 1.1
Identities = 23/154 (14%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S++ + S ++ + + S +
Sbjct: 628 SASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 687

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 688 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSD 747

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S +++D D+ D +SD
Sbjct: 748 SDSDSDSDSDSDSDSDSDSASDSDSDSDSDSDSD 781



Score = 33.1 bits (74), Expect = 1.1
Identities = 23/154 (14%), Positives = 62/154 (40%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + + ++ + D +S++ + S ++ + + S +
Sbjct: 634 SASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 693

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 694 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSD 753

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + ++ S + +D D+ D +SD
Sbjct: 754 SDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSD 787



Score = 32.7 bits (73), Expect = 1.5
Identities = 26/154 (16%), Positives = 57/154 (37%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S++ + S ++ +
Sbjct: 593 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDS 652

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
D + S +D+ S S SD D+ ++ + D + + S+ D
Sbjct: 653 DSDSDSDSDSDSDSDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 711

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S +++D D+ D +SD
Sbjct: 712 SDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSD 745



Score = 32.3 bits (72), Expect = 1.9
Identities = 23/151 (15%), Positives = 58/151 (38%)
Frame = -3

Query: 489 EKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGS 310
+ + S S + + + D +S++ + S ++ + + S + S
Sbjct: 633 DSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 692

Query: 309 EDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDV 130
+ + +S + + + S SD D+ ++ + D + + S+ D D
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 752

Query: 129 NKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ +D + + S + +D D+ D +SD
Sbjct: 753 DSDSDSDSDSDSDSASDSDSDSDSDSDSDSD 783



Score = 32.3 bits (72), Expect = 1.9
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 659 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 718

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 719 DSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSDS 778

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 779 DSDSDSDSDSDSDSDSD 795



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 695 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDS 754

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 755 DSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSES 814

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 815 DSDSDSDSDSDSDSDSD 831



Score = 32.0 bits (71), Expect = 2.5
Identities = 23/137 (16%), Positives = 56/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 705 DSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 764

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ D S +D + ++ + + S+ D D +D + + S
Sbjct: 765 DSASDSDSDSDS-DSDSDSDSDSDSDSDS---DSDSDSDSDSDSDSESDSDSESDSDSDS 820

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 821 DSDSDSDSDSDSASDSD 837



Score = 31.6 bits (70), Expect = 3.3
Identities = 29/165 (17%), Positives = 65/165 (39%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D ++++ + S ++
Sbjct: 609 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDS 668

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 669 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 728

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+++ S+ D D + +D SD DS S + +D D+ D +SD
Sbjct: 729 DSNSDSDSDSDSDSDSDSD-SDSDS-DSDSDSDSDSDSDSASDSD 771



Score = 31.2 bits (69), Expect = 4.3
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 714

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ + + D + + S+ D D + +D + + + S
Sbjct: 715 DSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDS 774

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 775 DSDSDSDSDSDSDSDSD 791



Score = 31.2 bits (69), Expect = 4.3
Identities = 23/137 (16%), Positives = 57/137 (41%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 691 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDS 750

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ SA+D + ++ + + S+ D D + +D + + S
Sbjct: 751 DSDSDSDSDSDSD---SDSASDSDSDSD---SDSDSDSDSDSDSDSDSDSDSDSDSDSDS 804

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 805 DSESDSDSESDSDSDSD 821



Score = 30.8 bits (68), Expect = 5.6
Identities = 25/165 (15%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + + S S + ++ + D +S++ + S ++
Sbjct: 633 DSASDSDSASDSDSDNDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 692

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD ++ ++ + D
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSDSDSDSDSDS 752

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D +D + + S + +D D+ D +SD
Sbjct: 753 DSDSDSDSDSDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 797



Score = 30.4 bits (67), Expect = 7.4
Identities = 23/138 (16%), Positives = 58/138 (42%), Gaps = 1/138 (0%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 667 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 726

Query: 267 STVSTSDKSGDT-GDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTP 91
+ S SD D+ D S +D + ++ + + S+ D + D + +D + +
Sbjct: 727 DSDSNSDSDSDSDSDSDSDSDSDSDSDSD---SDSDSDSDSDSASDSDSDSDSDSDSDSD 783

Query: 90 SYTSADGDNMKDILDESD 37
S + +D D+ D +SD
Sbjct: 784 SDSDSDSDSDSDSDSDSD 801


>sp|Q5ZMU6|PP4R2_CHICK Serine/threonine-protein phosphatase 4
regulatory subunit 2 OS=Gallus gallus GN=PPP4R2 PE=2
SV=1
Length = 405

Score = 45.8 bits (107), Expect = 2e-04
Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 23/146 (15%)
Frame = -3

Query: 405 SVSNAEGSVEETKQHK------SKNEGAQPASVQNLGSEDEQVE-------------ESS 283
S + E S+++T+ K S +EGAQ + V+N SED+ E E
Sbjct: 196 STEHKESSLQQTEDKKHSDSPASDSEGAQSSPVKNKHSEDDPAEAEGHEVKRLKFDKEGE 255

Query: 282 INDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMH---TSAASEEDISPDVNKGADF 112
D P+ ++S+ S G+ ETS+ +K + + T EE N G D
Sbjct: 256 ARDAPNQSASSEVSLGMGEESETSSTSQDKEKDSICARQHCTEEDEEESFMSPRNAGPDR 315

Query: 111 SD-EDSTPSYTSADGDNMKDILDESD 37
D E T S T + + ++ ++ESD
Sbjct: 316 KDQEKDTESSTVNEESSEENQMEESD 341



Score = 35.4 bits (80), Expect = 0.23
Identities = 34/147 (23%), Positives = 63/147 (42%), Gaps = 8/147 (5%)
Frame = -3

Query: 420 ENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKS 241
+++ + VS G ET E + Q+ EDE EES ++ + D+
Sbjct: 262 QSASSEVSLGMGEESETSSTSQDKEKDSICARQHCTEEDE--EESFMSPRNAGPDRKDQE 319

Query: 240 GDTGDLLETSAADDEKPAEPVVMHTSAA-SEEDISPD-------VNKGADFSDEDSTPSY 85
DT E+S ++E E + + + +E+D+ D V+ GAD S+ + SY
Sbjct: 320 KDT----ESSTVNEESSEENQMEESDQSQAEKDLHSDNSESSGSVSSGADCSETEELGSY 375

Query: 84 TSADGDNMKDILDESDMPDKLISEEPL 4
S + + E+ +++EP+
Sbjct: 376 GSETPETSSETPMENSEEATEVADEPM 402


>sp|Q99VJ4|CLFA_STAAN Clumping factor A OS=Staphylococcus aureus
(strain N315) GN=clfA PE=1 SV=1
Length = 989

Score = 45.8 bits (107), Expect = 2e-04
Identities = 27/142 (19%), Positives = 62/142 (43%), Gaps = 2/142 (1%)
Frame = -3

Query: 456 DVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSIN 277
++ P++ D S++ + S ++ + + G+ AS + S+ + +S
Sbjct: 553 EIEPIPEDSDSDPGSDSGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSA 612

Query: 276 DNPSTVSTSDKSGDTGDLLETSAADDEKPA--EPVVMHTSAASEEDISPDVNKGADFSDE 103
+ + S SD + D+ ++ +A D A + +AS+ D + D + +D +
Sbjct: 613 SDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSD 672

Query: 102 DSTPSYTSADGDNMKDILDESD 37
+ S + +D D+ D +SD
Sbjct: 673 SDSDSDSDSDSDSDSDSDSDSD 694



Score = 40.4 bits (93), Expect = 0.007
Identities = 26/148 (17%), Positives = 60/148 (40%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + S+++ + S ++ + AS + S+ +
Sbjct: 569 SGSDSNSDSGSDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 628

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + S SD + D+ ++ +A D A + + S+ D D +
Sbjct: 629 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSD 688

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 689 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 716



Score = 38.9 bits (89), Expect = 0.021
Identities = 25/148 (16%), Positives = 60/148 (40%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+GS S + ++ + D +S+++ + S ++ + AS + S+ +
Sbjct: 581 SGSDSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 640

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + S SD + D+ ++ + D + + S+ D D +
Sbjct: 641 SASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 700

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 701 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 728



Score = 38.1 bits (87), Expect = 0.035
Identities = 25/151 (16%), Positives = 61/151 (40%)
Frame = -3

Query: 489 EKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGS 310
+ T+ S S + ++ + D +S+++ + S ++ + AS + S
Sbjct: 584 DSTSDSGSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSAS 643

Query: 309 EDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDV 130
+ + +S + + S SD + D+ ++ + D + + S+ D D
Sbjct: 644 DSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 703

Query: 129 NKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ +D + + S + +D D+ D +SD
Sbjct: 704 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 734



Score = 36.2 bits (82), Expect = 0.13
Identities = 24/154 (15%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S+++ + S ++ + AS +
Sbjct: 599 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 658

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 659 SASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 718

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 719 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 752



Score = 35.4 bits (80), Expect = 0.23
Identities = 24/148 (16%), Positives = 58/148 (39%)
Frame = -3

Query: 480 TGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDE 301
+ S S + ++ + D +S+++ + S ++ + AS + S+ +
Sbjct: 593 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 652

Query: 300 QVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKG 121
+S + + S SD D+ ++ + D + + S+ D D +
Sbjct: 653 SASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 712

Query: 120 ADFSDEDSTPSYTSADGDNMKDILDESD 37
+D + + S + +D D+ D +SD
Sbjct: 713 SDSDSDSDSDSDSDSDSDSDSDSDSDSD 740



Score = 35.0 bits (79), Expect = 0.30
Identities = 26/154 (16%), Positives = 57/154 (37%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
A++ + A+D ++ AS S++ + S ++ + +
Sbjct: 594 ASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDS 653

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
D + S +D+ S S SD D+ ++ + D + + S+ D
Sbjct: 654 ASDSDSASDSDSASDSDSD-SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 712

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 713 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 746



Score = 35.0 bits (79), Expect = 0.30
Identities = 24/154 (15%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S+++ + S ++ + AS +
Sbjct: 605 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 664

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 665 SASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 724

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 725 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 758



Score = 35.0 bits (79), Expect = 0.30
Identities = 22/137 (16%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 736 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 795

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D A + + S+ D D + +D + + S
Sbjct: 796 DSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDS 855

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 856 ESDSDSDSDSDSESDSD 872



Score = 34.7 bits (78), Expect = 0.39
Identities = 26/165 (15%), Positives = 62/165 (37%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ ++ S ++
Sbjct: 598 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDS 657

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 658 DSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 717

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 718 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 762



Score = 34.7 bits (78), Expect = 0.39
Identities = 24/154 (15%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S+++ + S ++ + AS +
Sbjct: 611 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSD 670

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 671 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 730

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 731 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 764



Score = 34.3 bits (77), Expect = 0.51
Identities = 26/165 (15%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ + D +S++ + S ++
Sbjct: 640 DSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 699

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 700 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 759

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 760 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 804



Score = 33.9 bits (76), Expect = 0.67
Identities = 23/137 (16%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 734 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 793

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + SE D D + +D + + S
Sbjct: 794 DSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDS 853

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D ESD
Sbjct: 854 DSESDSDSDSDSDSESD 870



Score = 33.5 bits (75), Expect = 0.87
Identities = 26/165 (15%), Positives = 61/165 (36%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ ++ S ++
Sbjct: 592 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDS 651

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S + +S + + + S SD D+ ++ + D
Sbjct: 652 DSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 711

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 712 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 756



Score = 33.5 bits (75), Expect = 0.87
Identities = 26/165 (15%), Positives = 62/165 (37%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ ++ S ++
Sbjct: 604 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDS 663

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 664 DSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 723

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 724 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 768



Score = 33.5 bits (75), Expect = 0.87
Identities = 26/165 (15%), Positives = 62/165 (37%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ ++ S ++
Sbjct: 616 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDS 675

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 676 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 735

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 736 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 780



Score = 33.5 bits (75), Expect = 0.87
Identities = 23/154 (14%), Positives = 61/154 (39%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S+++ + S ++ + + S +
Sbjct: 629 SASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSD 688

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 689 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 748

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 749 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 782



Score = 33.1 bits (74), Expect = 1.1
Identities = 26/165 (15%), Positives = 62/165 (37%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D S++ ++ S ++
Sbjct: 610 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSASDS 669

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 670 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 729

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 730 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 774



Score = 33.1 bits (74), Expect = 1.1
Identities = 26/165 (15%), Positives = 62/165 (37%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ D +S++ + S ++
Sbjct: 634 DSASDSDSASDSDSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDS 693

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 694 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 753

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 754 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 798



Score = 33.1 bits (74), Expect = 1.1
Identities = 26/165 (15%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ + D +S++ + S ++
Sbjct: 646 DSASDSDSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 705

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 706 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 765

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 766 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 810



Score = 32.7 bits (73), Expect = 1.5
Identities = 26/165 (15%), Positives = 63/165 (38%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
D A + A + + S S + ++ + D +S++ + S ++
Sbjct: 652 DSASDSDSASDSDSASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 711

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ + S + S+ + +S + + + S SD D+ ++ + D
Sbjct: 712 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 771

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
+ + S+ D D + +D + + S + +D D+ D +SD
Sbjct: 772 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 816



Score = 32.7 bits (73), Expect = 1.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 690 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 749

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 750 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 809

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 810 DSDSDSDSDSDSASDSD 826



Score = 32.7 bits (73), Expect = 1.5
Identities = 26/128 (20%), Positives = 56/128 (43%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ +A S ++ + + S + S+ + ES + +
Sbjct: 804 DSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSESDSDSDS 863

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ D SA+D + ++ + ++S+ D + G+D +D DS +
Sbjct: 864 DSDSESDSDSDS-DSDSDSASDSDSGSD-----SDSSSDSDSDSTSDTGSD-NDSDSDSN 916

Query: 87 YTSADGDN 64
S G N
Sbjct: 917 SDSESGSN 924



Score = 32.3 bits (72), Expect = 1.9
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 694 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 753

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 754 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 813

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 814 DSDSDSDSASDSDSDSD 830



Score = 32.3 bits (72), Expect = 1.9
Identities = 21/137 (15%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 700 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 759

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 760 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 819

Query: 87 YTSADGDNMKDILDESD 37
+++D D+ D +SD
Sbjct: 820 DSASDSDSDSDSESDSD 836



Score = 32.3 bits (72), Expect = 1.9
Identities = 28/145 (19%), Positives = 58/145 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 726 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 785

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + +AS+ D D +D SD DS S
Sbjct: 786 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSESDSD-SDSDS-DS 843

Query: 87 YTSADGDNMKDILDESDMPDKLISE 13
+ +D D+ D +SD SE
Sbjct: 844 DSDSDSDSDSDSESDSDSDSDSDSE 868



Score = 32.0 bits (71), Expect = 2.5
Identities = 23/154 (14%), Positives = 60/154 (38%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
+ + + S S + ++ + D +S++ + S ++ + + S +
Sbjct: 665 SASDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 724

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
S+ + +S + + + S SD D+ ++ + D + + S+ D
Sbjct: 725 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 784

Query: 138 PDVNKGADFSDEDSTPSYTSADGDNMKDILDESD 37
D + +D + + S + +D D+ D +SD
Sbjct: 785 SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 818



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 704 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 763

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 764 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSAS 823

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 824 DSDSDSDSESDSDSDSD 840



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 55/137 (40%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 710 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 769

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + + S
Sbjct: 770 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDS 829

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 830 DSESDSDSDSDSDSDSD 846



Score = 32.0 bits (71), Expect = 2.5
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 714 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 773

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 774 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSES 833

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 834 DSDSDSDSDSDSDSDSD 850



Score = 31.6 bits (70), Expect = 3.3
Identities = 21/137 (15%), Positives = 54/137 (39%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 684 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 743

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D + +D + + S
Sbjct: 744 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 803

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 804 DSDSDSDSDSDSDSDSD 820



Score = 31.2 bits (69), Expect = 4.3
Identities = 20/137 (14%), Positives = 53/137 (38%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 750 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 809

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + + + + S+ D D +D + + S
Sbjct: 810 DSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSES 869

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 870 DSDSDSDSDSDSASDSD 886



Score = 30.4 bits (67), Expect = 7.4
Identities = 21/137 (15%), Positives = 53/137 (38%)
Frame = -3

Query: 447 ETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSINDNP 268
++ + D +S++ + S ++ + + S + S+ + +S + +
Sbjct: 716 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS 775

Query: 267 STVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPS 88
+ S SD D+ ++ + D + + S+ D D +D + + S
Sbjct: 776 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSASDSDSDSDSESDS 835

Query: 87 YTSADGDNMKDILDESD 37
+ +D D+ D +SD
Sbjct: 836 DSDSDSDSDSDSDSDSD 852


tr_hit_id Q252P1
Definition tr|Q252P1|Q252P1_CHLFF Adenylate cyclase OS=Chlamydophila felis (strain Fe/C-56)
Align length 181
Score (bit) 52.4
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920615|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_C09.
(608 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q252P1|Q252P1_CHLFF Adenylate cyclase OS=Chlamydophila felis ... 52 2e-05
tr|Q5CIJ6|Q5CIJ6_CRYHO Cutinase negative acting protein OS=Crypt... 52 3e-05
tr|Q6CTM6|Q6CTM6_KLULA KLLA0C11495p OS=Kluyveromyces lactis GN=K... 52 3e-05
tr|A2EMQ3|A2EMQ3_TRIVA Putative uncharacterized protein OS=Trich... 52 3e-05
tr|A7TJN8|A7TJN8_VANPO Putative uncharacterized protein OS=Vande... 51 5e-05
tr|A2FD98|A2FD98_TRIVA Putative uncharacterized protein OS=Trich... 51 6e-05
tr|Q6C1J9|Q6C1J9_YARLI YALI0F15653p OS=Yarrowia lipolytica GN=YA... 51 6e-05
tr|Q4P120|Q4P120_USTMA Putative uncharacterized protein OS=Ustil... 51 6e-05
tr|A6RK10|A6RK10_BOTFB Putative uncharacterized protein OS=Botry... 51 6e-05
tr|Q0ECW6|Q0ECW6_ENTHI Serine-rich protein OS=Entamoeba histolyt... 50 8e-05
tr|B6PP56|B6PP56_BRAFL Putative uncharacterized protein OS=Branc... 50 8e-05
tr|B6MD59|B6MD59_BRAFL Putative uncharacterized protein OS=Branc... 50 8e-05
tr|A7ASN4|A7ASN4_BABBO Putative uncharacterized protein OS=Babes... 50 1e-04
tr|Q6FLE1|Q6FLE1_CANGA Similar to uniprot|P53919 Saccharomyces c... 50 1e-04
tr|Q16G64|Q16G64_AEDAE Putative uncharacterized protein (Fragmen... 50 1e-04
tr|Q07593|Q07593_ENTHI K2 protein (Fragment) OS=Entamoeba histol... 50 1e-04
tr|O15611|O15611_ENTHI Serine rich 25 kD antigen protein (Fragme... 50 1e-04
tr|A2ESJ8|A2ESJ8_TRIVA F/Y-rich N-terminus family protein OS=Tri... 50 1e-04
tr|B3KXM1|B3KXM1_HUMAN cDNA FLJ45705 fis, clone FEBRA2028222, hi... 50 1e-04
tr|Q6MFI1|Q6MFI1_NEUCR Putative uncharacterized protein B10H18.2... 50 1e-04
tr|B8MGL0|B8MGL0_9EURO Ribosome assembly and transport protein S... 49 2e-04
tr|A6QX01|A6QX01_AJECN Predicted protein OS=Ajellomyces capsulat... 49 2e-04
tr|A5DK21|A5DK21_PICGU Putative uncharacterized protein OS=Pichi... 49 2e-04
tr|Q5TQE4|Q5TQE4_ANOGA AGAP008244-PA OS=Anopheles gambiae GN=AGA... 49 2e-04
tr|Q0ECV9|Q0ECV9_ENTDI Serin-rich protein (Fragment) OS=Entamoeb... 49 2e-04
tr|B6M489|B6M489_BRAFL Putative uncharacterized protein OS=Branc... 49 2e-04
tr|Q40363|Q40363_MEDSA NuM1 protein OS=Medicago sativa GN=nuM1 P... 49 3e-04
tr|Q9VGW4|Q9VGW4_DROME CG14692 OS=Drosophila melanogaster GN=CG1... 49 3e-04
tr|Q0ECV8|Q0ECV8_ENTDI Serin-rich protein (Fragment) OS=Entamoeb... 49 3e-04
tr|B4MTR2|B4MTR2_DROWI GK23783 OS=Drosophila willistoni GN=GK237... 49 3e-04

>tr|Q252P1|Q252P1_CHLFF Adenylate cyclase OS=Chlamydophila felis
(strain Fe/C-56) GN=adc PE=4 SV=1
Length = 841

Score = 52.4 bits (124), Expect = 2e-05
Identities = 46/181 (25%), Positives = 84/181 (46%), Gaps = 10/181 (5%)
Frame = -3

Query: 516 VTVAP-PATEEKTTGSFSKAT-DVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE- 346
+ V+P PA +K T SKA+ D P +++S+AS S+ + + E +K+E
Sbjct: 118 INVSPEPADRKKKTEKQSKASQDRATKPSPATQQDSSDASPSDKDKELAEAFLASAKSEQ 177

Query: 345 --GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+Q + +L E+ ES + D +T + + G L +++P
Sbjct: 178 KTSSQKIDIDSLSVAGEKKTESPLGDVKTTATQHATMEENGALPN----QNQQPLPDSAP 233

Query: 171 HTSAASEEDISPDVNKGAD----FSDEDSTPSYTSADG-DNMKDILDESDMPDKLISEEP 7
T S+ED P N+ F+ E++TP T+ DG N+++ DE +++ +EE
Sbjct: 234 ATQDQSKEDGQPKANEPVKEPPAFNQEETTPQVTATDGSQNVEEPQDEEASKEQVANEEK 293

Query: 6 L 4
+
Sbjct: 294 I 294



Score = 35.4 bits (80), Expect = 2.6
Identities = 28/114 (24%), Positives = 48/114 (42%)
Frame = -3

Query: 525 AREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE 346
A E PPA ++ T ATD + +E +E S+ V+N E E ++ K E
Sbjct: 247 ANEPVKEPPAFNQEETTPQVTATDGSQNVEEPQDEEASKEQVANEEKIEENPEEESQKPE 306

Query: 345 GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAE 184
+ A + E + EE S+ S ++ D+ + E + ++ K E
Sbjct: 307 --KEAKEEGSSKEQDTSEEDSVEK-----SEEEEDQDSDKVTEEESKEENKKTE 353


>tr|Q5CIJ6|Q5CIJ6_CRYHO Cutinase negative acting protein
OS=Cryptosporidium hominis GN=Chro.30466 PE=4 SV=1
Length = 475

Score = 52.0 bits (123), Expect = 3e-05
Identities = 39/152 (25%), Positives = 76/152 (50%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T AP ++ + S S ++D + ++ K+NS+A+ K++ S + +
Sbjct: 65 TAAPTPAKKAMSDSSSSSSDSSSSSEDEQPKKNSKAAAP--------MKKNISNSSSSSS 116

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+S + SEDEQ ++++ P + S+ S D+ ++S+++DEKP + TS +
Sbjct: 117 SSDSDSSSEDEQPKKNAKAATPMKKNISNSSLDSSSSSDSSSSEDEKPKKNTKATTSTTA 176

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSADGDNMK 58
++ +S D S DS+ S + +D DN K
Sbjct: 177 KKTMS-------DSSSSDSSSS-SDSDSDNEK 200



Score = 42.7 bits (99), Expect = 0.016
Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 13/173 (7%)
Frame = -3

Query: 489 EKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNLGS 310
+ ++ S S ++D + ++ K+N++ + S T K+ ++ + +S + S
Sbjct: 3 DSSSSSESSSSDSSSSSEDEQPKKNTKPATS--------TTPKKTMSDSSSSSSDSSSSS 54

Query: 309 EDEQVEES--SINDNPSTVSTSDKSGDTGDLLETSAADDEKP------AEPVVMHTSAAS 154
EDEQ +++ + P+ + SD S + D +S+++DE+P A P+ + S +S
Sbjct: 55 EDEQPKKNTKTAAPTPAKKAMSDSSSSSSD--SSSSSEDEQPKKNSKAAAPMKKNISNSS 112

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSADGDNMK-----DILDESDMPDKLISEE 10
S D +D S ED P + MK LD S D SE+
Sbjct: 113 SSSSSSD----SDSSSEDEQPKKNAKAATPMKKNISNSSLDSSSSSDSSSSED 161


>tr|Q6CTM6|Q6CTM6_KLULA KLLA0C11495p OS=Kluyveromyces lactis
GN=KLLA0C11495g PE=4 SV=1
Length = 445

Score = 52.0 bits (123), Expect = 3e-05
Identities = 43/179 (24%), Positives = 80/179 (44%), Gaps = 2/179 (1%)
Frame = -3

Query: 537 KRDLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHK 358
K+D + V P ++ + ++ S S ++ + D +S + S++ EE K+
Sbjct: 23 KQDEKKVKAVEPESSSDSSSDSSSDSSSDSSSDSSSDSDSSSSSDSSDSSDEEEEPKKET 82

Query: 357 SKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPV 178
K E + + + + + EE+ ++ + S+SD S D+ S ++EK E
Sbjct: 83 KKEESSSDSESSSDSDSESEKEEAKKEESSDSDSSSDSSSDSDS---DSDEEEEKKEEKK 139

Query: 177 VMHTSA-ASEEDISPDVNKGADFSDEDSTPS-YTSADGDNMKDILDESDMPDKLISEEP 7
+SA +S+ D S D + +D +E+ S AD D K ES P ++ EP
Sbjct: 140 KEESSASSSDSDSSSDSDSSSDDDEEEEKSSNKRKADDDEEK---SESKKPKTELAGEP 195


>tr|A2EMQ3|A2EMQ3_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_244800 PE=4 SV=1
Length = 574

Score = 51.6 bits (122), Expect = 3e-05
Identities = 38/167 (22%), Positives = 73/167 (43%)
Frame = -3

Query: 525 AREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE 346
+ E T + ++ E+TT S S +++ + +SE + S++ S EET S +
Sbjct: 238 SEETTSSSSSSSEETTSSSSSSSEETTSSSS----SSSEETTSSSSSSSEETTSSSSSSS 293

Query: 345 GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHT 166
+S + SE E +S + +PS +TS S + +S++ P+E +
Sbjct: 294 EETTSSSSSSSSE----ETTSYSSSPSEETTSSSSSSPSEETTSSSSSSSSPSEETTSSS 349

Query: 165 SAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDK 25
S+ SEE S + + + S+ S +S+ + S +K
Sbjct: 350 SSPSEETTSSSSSSSSPSEETTSSSSSSSSPSEETTSSSSTSSSTEK 396



Score = 46.2 bits (108), Expect = 0.001
Identities = 32/137 (23%), Positives = 61/137 (44%)
Frame = -3

Query: 498 ATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQN 319
++EE T+ S S + + + +E + +S S++ S E T S +E +S +
Sbjct: 304 SSEETTSYSSSPSEETTSSSSSSPSEETTSSSSSSSSPSEETTSSSSSPSEETTSSSSSS 363

Query: 318 LGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS 139
+E SS + +PS +TS S + E + D K P +++SAAS+ +
Sbjct: 364 SSPSEETTSSSSSSSSPSEETTSSSSTSSSTEKEETPIIDPKTPIPPPVNSSAASQNNTV 423

Query: 138 PDVNKGADFSDEDSTPS 88
+ + + + D S
Sbjct: 424 EESSTNSSSGNSDPNNS 440



Score = 45.4 bits (106), Expect = 0.003
Identities = 36/160 (22%), Positives = 70/160 (43%)
Frame = -3

Query: 525 AREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE 346
+ E T + ++ E+TT S S +++ + +SE + S++ S EET S +
Sbjct: 249 SEETTSSSSSSSEETTSSSSSSSEETTSSSS----SSSEETTSSSSSSSEETTSSSSSSS 304

Query: 345 GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHT 166
+ S + SE+ SS +T S+S S + + +S++ E+ +
Sbjct: 305 SEETTSYSSSPSEETTSSSSSSPSEETTSSSSSSSSPSEETTSSSSSPSEETTSSS-SSS 363

Query: 165 SAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILD 46
S+ SEE S + + + S+ S +S+ I+D
Sbjct: 364 SSPSEETTSSSSSSSSPSEETTSSSSTSSSTEKEETPIID 403


>tr|A7TJN8|A7TJN8_VANPO Putative uncharacterized protein
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=Kpol_1058p4 PE=4 SV=1
Length = 4380

Score = 51.2 bits (121), Expect = 5e-05
Identities = 43/149 (28%), Positives = 68/149 (45%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E S EET + + E +
Sbjct: 709 EETSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEEE-STEETSEPTTTEEES 763

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
+ + +E+E EE+S PST + + +T + T E P+EP T
Sbjct: 764 TQETSEPSTTEEESTEETS---EPSTTE-EESTQETSEPTTTEEQSTETPSEPTT--TEE 817

Query: 159 ASEEDISPDVNKGADFSDEDSTPSYTSAD 73
S E+ S + ++E S PS T +
Sbjct: 818 ESTEETSEPSTTEEESTEETSEPSTTEEE 846



Score = 48.1 bits (113), Expect = 4e-04
Identities = 41/147 (27%), Positives = 67/147 (45%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T P TEE++T S+ T T +E +E SE S + E S EET + + E +
Sbjct: 1033 TSEPSTTEEESTEETSEPT----TTEEESTQETSEPSTTEEE-STEETSEPSTTEEESTQ 1087

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+ + +E+E EE+S PST + + +T + T E+ +EP T S
Sbjct: 1088 ETSEPSTTEEESTEETS---EPSTTE-EESTEETSEPSTTEEESTEETSEPTT--TEEES 1141

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
++ S + ++E S PS T +
Sbjct: 1142 TQETSEPSTTEEESTEETSEPSTTEEE 1168



Score = 47.0 bits (110), Expect = 9e-04
Identities = 40/158 (25%), Positives = 68/158 (43%), Gaps = 9/158 (5%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E + E ++ ++ E
Sbjct: 933 EETSEPSTTEEESTQETSEPS----TTEEESTEETSEPSTTEEESTEETSEPSTTEQEST 988

Query: 339 QPASVQNLGSED--EQVEESSINDNPSTVSTSD-------KSGDTGDLLETSAADDEKPA 187
Q S + E+ E+ E S + ST TS+ + +T + T E+ +
Sbjct: 989 QETSEPSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEETS 1048

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
EP T S ++ S + ++E S PS T +
Sbjct: 1049 EPTT--TEEESTQETSEPSTTEEESTEETSEPSTTEEE 1084



Score = 45.8 bits (107), Expect = 0.002
Identities = 32/168 (19%), Positives = 66/168 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + +E+ Q S+ +
Sbjct: 1234 TTEEESTEETSEPSTTEEESTEETSEPTTTEEESTEETSEPSTTEQESTQETSEPSTTEE 1293

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S + EES+ + T + + + +T + T E+ +EP T S
Sbjct: 1294 ESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTDEESTEETSEPTT--TEEES 1351

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDKLISEE 10
++ S + ++E S PS T + + + ++ + ++ E
Sbjct: 1352 TQETSEPSTTEEESTEETSEPSTTEEESTEATETTETTEATESTLASE 1399



Score = 44.3 bits (103), Expect = 0.006
Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E S EET + + E +
Sbjct: 541 EETSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEEE-STEETSEPSTTEEES 595

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
+ + +E+E EE+S PST + + +T + T E+ +EP
Sbjct: 596 TEETSEPTTTEEESTEETS---EPSTTE-QESTQETSEPSTTEEESTEETSEPTT----- 646

Query: 159 ASEEDISPDVNKGA----DFSDEDSTPSYTSAD 73
+EE+ + + ++ + + ++E S PS T +
Sbjct: 647 -TEEESTEETSEPSTTEEESTEETSEPSTTEEE 678



Score = 43.9 bits (102), Expect = 0.007
Identities = 39/153 (25%), Positives = 73/153 (47%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E + E ++ ++ E
Sbjct: 429 EETSEPSTTEEESTQETSEPS----TTEEESTEETSEPSTTEEESTQETSEPTTTEEEST 484

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
Q S + +E+E EE+S PST + + +T + T E+ +EP +
Sbjct: 485 QETSEPST-TEEESTEETS---EPSTTE-EESTQETSEPTTTEEESTEETSEP------S 533

Query: 159 ASEEDISPDVNKGA----DFSDEDSTPSYTSAD 73
+EE+ + + ++ + + ++E S PS T +
Sbjct: 534 TTEEESTEETSEPSTTEEESTEETSEPSTTEEE 566



Score = 43.9 bits (102), Expect = 0.007
Identities = 38/147 (25%), Positives = 67/147 (45%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T + P T E+ + ++ T T +E +E SE S + E S EET + + E +
Sbjct: 808 TPSEPTTTEEES---TEETSEPSTTEEESTEETSEPSTTEEE-STEETSEPSTTEEESTQ 863

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+ + +E+E EE+S PST + + + +T + T ++ +EP T S
Sbjct: 864 ETSEPSTTEEESTEETS---EPST-TEEESTQETSEPTTTEEESTQETSEPTT--TEEES 917

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + ++E S PS T +
Sbjct: 918 TEETSEPSTTEEESTEETSEPSTTEEE 944



Score = 43.5 bits (101), Expect = 0.010
Identities = 41/163 (25%), Positives = 77/163 (47%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E + E ++ ++ E
Sbjct: 639 EETSEPTTTEEESTEETSEPS----TTEEESTEETSEPSTTEEESTEETSEPSTTEQEST 694

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
Q S + +E+E EE+S PST + + +T + T E+ +EP +
Sbjct: 695 QETSEPST-TEEESTEETS---EPSTTE-EESTEETSEPSTTEEESTEETSEP------S 743

Query: 159 ASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMP 31
+EE+ + + ++ ++E+ST TS ++ +E+ P
Sbjct: 744 TTEEESTEETSEPTT-TEEESTQE-TSEPSTTEEESTEETSEP 784



Score = 43.5 bits (101), Expect = 0.010
Identities = 39/153 (25%), Positives = 73/153 (47%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E S EET + + E +
Sbjct: 1073 EETSEPSTTEEESTQETSEPS----TTEEESTEETSEPSTTEEE-STEETSEPSTTEEES 1127

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
+ + +E+E +E+S PST + + +T + T E+ +EP +
Sbjct: 1128 TEETSEPTTTEEESTQETS---EPSTTE-EESTEETSEPSTTEEESTEETSEP------S 1177

Query: 159 ASEEDISPDVNKGA----DFSDEDSTPSYTSAD 73
+EE+ + + ++ + + ++E S PS T +
Sbjct: 1178 TTEEESTEETSEPSTTEEESTEETSEPSTTEEE 1210



Score = 43.5 bits (101), Expect = 0.010
Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ T T +E +E SE S + E + E T + +S
Sbjct: 1115 EETSEPSTTEEESTEETSEPT----TTEEESTQETSEPSTTEEESTEETSEPSTTEEEST 1170

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
E ++P++ + +E E E S+ + ST TS+ S T E+ +EP
Sbjct: 1171 EETSEPSTTEEESTE-ETSEPST-TEEESTEETSEPS-------TTEEESTEETSEPST- 1220

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + ++E S PS T +
Sbjct: 1221 -TEEESTEETSEPSTTEEESTEETSEPSTTEEE 1252



Score = 43.1 bits (100), Expect = 0.012
Identities = 43/153 (28%), Positives = 67/153 (43%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ T T +E +E SE S + E + E T + +S
Sbjct: 457 EETSEPSTTEEESTQETSEPT----TTEEESTQETSEPSTTEEESTEETSEPSTTEEEST 512

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
E ++P + + +E E E S+ + ST TS+ S T E+ +EP
Sbjct: 513 QETSEPTTTEEESTE-ETSEPST-TEEESTEETSEPS-------TTEEESTEETSEPST- 562

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + ++E S PS T +
Sbjct: 563 -TEEESTEETSEPSTTEEESTEETSEPSTTEEE 594



Score = 43.1 bits (100), Expect = 0.012
Identities = 33/147 (22%), Positives = 57/147 (38%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ Q S+ +
Sbjct: 814 TTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTTEE 873

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S + EES+ + T + + + +T + T E+ +EP T S
Sbjct: 874 ESTEETSEPSTTEEESTQETSEPTTTEEESTQETSEPTTTEEESTEETSEPST--TEEES 931

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + + E S PS T +
Sbjct: 932 TEETSEPSTTEEESTQETSEPSTTEEE 958



Score = 43.1 bits (100), Expect = 0.012
Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 2/169 (1%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T P TEE++T S+ T T +E +E SE S + E S EET + + E +
Sbjct: 893 TSEPTTTEEESTQETSEPT----TTEEESTEETSEPSTTEEE-STEETSEPSTTEEESTQ 947

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+ + +E+E EE+S PST + + +T + T ++ +EP + +
Sbjct: 948 ETSEPSTTEEESTEETS---EPSTTE-EESTEETSEPSTTEQESTQETSEP------STT 997

Query: 153 EEDISPDVNKGADFSDE--DSTPSYTSADGDNMKDILDESDMPDKLISE 13
EE+ + + ++ + +E + T T+ + ++ ++ + S ++ E
Sbjct: 998 EEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEE 1046



Score = 42.7 bits (99), Expect = 0.016
Identities = 34/149 (22%), Positives = 60/149 (40%), Gaps = 5/149 (3%)
Frame = -3

Query: 504 PPATEEKTTGSFSKAT-----DVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
P TEE++T + S+ T ET + +E S S + EE+ Q S+
Sbjct: 392 PTTTEEQSTETPSEPTTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTT 451

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
+ S + EES+ + T + + + +T + T E+ +EP T
Sbjct: 452 EEESTEETSEPSTTEEESTQETSEPTTTEEESTQETSEPSTTEEESTEETSEPST--TEE 509

Query: 159 ASEEDISPDVNKGADFSDEDSTPSYTSAD 73
S ++ S + ++E S PS T +
Sbjct: 510 ESTQETSEPTTTEEESTEETSEPSTTEEE 538



Score = 42.7 bits (99), Expect = 0.016
Identities = 31/154 (20%), Positives = 61/154 (39%)
Frame = -3

Query: 534 RDLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKS 355
++ + T +TEE + S ++ ET + +E S S + EE+ + S
Sbjct: 513 QETSEPTTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETS 572

Query: 354 KNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVV 175
+ + S + EES+ + T + + + +T + T ++ +EP
Sbjct: 573 EPSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTEETSEPSTTEQESTQETSEPST 632

Query: 174 MHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + ++E S PS T +
Sbjct: 633 --TEEESTEETSEPTTTEEESTEETSEPSTTEEE 664



Score = 42.7 bits (99), Expect = 0.016
Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 11/160 (6%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ T T +E +E SE S + E + E T + +S
Sbjct: 583 EETSEPSTTEEESTEETSEPT----TTEEESTEETSEPSTTEQESTQETSEPSTTEEEST 638

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKS-------GDTGDLLETSAADDEK 193
E ++P + + +E E E S+ + ST TS+ S +T + T ++
Sbjct: 639 EETSEPTTTEEESTE-ETSEPST-TEEESTEETSEPSTTEEESTEETSEPSTTEQESTQE 696

Query: 192 PAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
+EP T S E+ S + ++E S PS T +
Sbjct: 697 TSEPST--TEEESTEETSEPSTTEEESTEETSEPSTTEEE 734



Score = 42.7 bits (99), Expect = 0.016
Identities = 37/153 (24%), Positives = 72/153 (47%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGA 340
E T P TEE++T S+ + T +E +E SE S + E S EET + + E +
Sbjct: 835 EETSEPSTTEEESTEETSEPS----TTEEESTQETSEPSTTEEE-STEETSEPSTTEEES 889

Query: 339 QPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSA 160
+ + +E+E +E+S T + + + +T + T E+ +EP +
Sbjct: 890 TQETSEPTTTEEESTQETS----EPTTTEEESTEETSEPSTTEEESTEETSEP------S 939

Query: 159 ASEEDISPDVNKGA----DFSDEDSTPSYTSAD 73
+EE+ + + ++ + + ++E S PS T +
Sbjct: 940 TTEEESTQETSEPSTTEEESTEETSEPSTTEEE 972



Score = 42.7 bits (99), Expect = 0.016
Identities = 39/151 (25%), Positives = 72/151 (47%), Gaps = 4/151 (2%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T P TEE++T S+ + T +E +E SE S + E S EET + + E +
Sbjct: 1089 TSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEEE-STEETSEPTTTEEESTQ 1143

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+ + +E+E EE+S PST + + +T + T E+ +EP + +
Sbjct: 1144 ETSEPSTTEEESTEETS---EPSTTE-EESTEETSEPSTTEEESTEETSEP------STT 1193

Query: 153 EEDISPDVNKGA----DFSDEDSTPSYTSAD 73
EE+ + + ++ + + ++E S PS T +
Sbjct: 1194 EEESTEETSEPSTTEEESTEETSEPSTTEEE 1224



Score = 42.4 bits (98), Expect = 0.021
Identities = 34/141 (24%), Positives = 64/141 (45%)
Frame = -3

Query: 495 TEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPASVQNL 316
TE++TTG + T +E + SE + + E S EET + + E + + +
Sbjct: 377 TEDETTGQSTNENSEPTTTEEQSTETPSEPTTTEEE-STEETSEPSTTEEESTEETSEPS 435

Query: 315 GSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDISP 136
+E+E +E+S PST + + + +T + T ++ +EP T S ++ S
Sbjct: 436 TTEEESTQETS---EPST-TEEESTEETSEPSTTEEESTQETSEPTT--TEEESTQETSE 489

Query: 135 DVNKGADFSDEDSTPSYTSAD 73
+ ++E S PS T +
Sbjct: 490 PSTTEEESTEETSEPSTTEEE 510



Score = 42.4 bits (98), Expect = 0.021
Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 5/152 (3%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVE-----TPQEVDLKENSEASVSNAEGSVEETKQHKSKN 349
T +TEE + S ++ E T +E +E SE S + E S EET + +
Sbjct: 492 TTEEESTEETSEPSTTEEESTQETSEPTTTEEESTEETSEPSTTEEE-STEETSEPSTTE 550

Query: 348 EGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMH 169
E + + + +E+E EE+S PST + + + +T + T E+ +EP
Sbjct: 551 EESTEETSEPSTTEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETSEPTT-- 604

Query: 168 TSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + + E S PS T +
Sbjct: 605 TEEESTEETSEPSTTEQESTQETSEPSTTEEE 636



Score = 42.4 bits (98), Expect = 0.021
Identities = 33/147 (22%), Positives = 57/147 (38%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ + S+ +
Sbjct: 562 TTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTEETSEPSTTEQ 621

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S Q EES+ + T + + + +T + T E+ +EP T S
Sbjct: 622 ESTQETSEPSTTEEESTEETSEPTTTEEESTEETSEPSTTEEESTEETSEPST--TEEES 679

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + + E S PS T +
Sbjct: 680 TEETSEPSTTEQESTQETSEPSTTEEE 706



Score = 42.4 bits (98), Expect = 0.021
Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 5/158 (3%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVE-----TPQEVDLKENSEASVSNAEGSVEETK 367
+ + T +T+E + S ++ E T +E +E SE S + E S EET
Sbjct: 1130 ETSEPTTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEEE-STEETS 1188

Query: 366 QHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPA 187
+ + E + + + +E+E EE+S PST + + + +T + T E+ +
Sbjct: 1189 EPSTTEEESTEETSEPSTTEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETS 1244

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
EP T S E+ S + ++E S PS T +
Sbjct: 1245 EPST--TEEESTEETSEPTTTEEESTEETSEPSTTEQE 1280



Score = 42.4 bits (98), Expect = 0.021
Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 5/152 (3%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVE-----TPQEVDLKENSEASVSNAEGSVEETKQHKSKN 349
T +TEE + S ++ E T +E +E SE S + E S EET + +
Sbjct: 1150 TTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEEE-STEETSEPSTTE 1208

Query: 348 EGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMH 169
E + + + +E+E EE+S PST + + + +T + T E+ +EP
Sbjct: 1209 EESTEETSEPSTTEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETSEPTT-- 1262

Query: 168 TSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + + E S PS T +
Sbjct: 1263 TEEESTEETSEPSTTEQESTQETSEPSTTEEE 1294



Score = 42.4 bits (98), Expect = 0.021
Identities = 35/146 (23%), Positives = 69/146 (47%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T P TEE++T S+ + T +E +E SE + + E S +ET + + +E +
Sbjct: 1285 TSEPSTTEEESTEETSEPS----TTEEESTEETSEPTTTEEE-STQETSEPSTTDEESTE 1339

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
+ + +E+E +E+S PST T ++S T + E S ++E T+ A+
Sbjct: 1340 ETSEPTTTEEESTQETS---EPST--TEEES--TEETSEPSTTEEESTEATETTETTEAT 1392

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSA 76
E ++ + + + ++ T T +
Sbjct: 1393 ESTLASESGESTETTESTETAEATES 1418



Score = 42.0 bits (97), Expect = 0.028
Identities = 32/147 (21%), Positives = 58/147 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ + S+ +
Sbjct: 968 TTEEESTEETSEPSTTEQESTQETSEPSTTEEESTEETSEPSTTEEESTEETSEPTTTEE 1027

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S Q EES+ + T + + + +T + T E+ +EP T S
Sbjct: 1028 ESTQETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEETSEPST--TEEES 1085

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
++ S + ++E S PS T +
Sbjct: 1086 TQETSEPSTTEEESTEETSEPSTTEEE 1112



Score = 42.0 bits (97), Expect = 0.028
Identities = 40/161 (24%), Positives = 65/161 (40%), Gaps = 14/161 (8%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVE-----TPQEVDLKENSEASVSNAEGSVEETKQHKSKN 349
T +TEE + S ++ E T +E +E SE S + E + E ++ ++
Sbjct: 996 TTEEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEETSEPTTTEE 1055

Query: 348 EGAQPASVQNLGSED--EQVEESSINDNPSTVSTSDKS-------GDTGDLLETSAADDE 196
E Q S + E+ E+ E S + ST TS+ S +T + T E
Sbjct: 1056 ESTQETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTE 1115

Query: 195 KPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
+ +EP T S E+ S + + E S PS T +
Sbjct: 1116 ETSEPST--TEEESTEETSEPTTTEEESTQETSEPSTTEEE 1154



Score = 41.6 bits (96), Expect = 0.036
Identities = 37/158 (23%), Positives = 67/158 (42%), Gaps = 4/158 (2%)
Frame = -3

Query: 534 RDLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVS----NAEGSVEETK 367
++ + T +T+E + S ++ ET + +E S S E S EET
Sbjct: 471 QETSEPTTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTQETSEPTTTEEESTEETS 530

Query: 366 QHKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPA 187
+ + E + + + +E+E EE+S PST + + + +T + T E+ +
Sbjct: 531 EPSTTEEESTEETSEPSTTEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETS 586

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
EP T S E+ S + ++E S PS T +
Sbjct: 587 EPST--TEEESTEETSEPTTTEEESTEETSEPSTTEQE 622



Score = 41.6 bits (96), Expect = 0.036
Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 4/157 (2%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQ----EVDLKENSEASVSNAEGSVEETKQ 364
+ + T +TEE + S ++ ET + E + E + + E S EET +
Sbjct: 598 ETSEPTTTEEESTEETSEPSTTEQESTQETSEPSTTEEESTEETSEPTTTEEESTEETSE 657

Query: 363 HKSKNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAE 184
+ E + + + +E+E EE+S PST + + + +T + T E+ +E
Sbjct: 658 PSTTEEESTEETSEPSTTEEESTEETS---EPST-TEQESTQETSEPSTTEEESTEETSE 713

Query: 183 PVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
P T S E+ S + ++E S PS T +
Sbjct: 714 PST--TEEESTEETSEPSTTEEESTEETSEPSTTEEE 748



Score = 41.6 bits (96), Expect = 0.036
Identities = 39/152 (25%), Positives = 65/152 (42%), Gaps = 5/152 (3%)
Frame = -3

Query: 513 TVAPPATEE-----KTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKN 349
T +TEE T ++ T T +E +E SE S + E + E ++ ++
Sbjct: 632 TTEEESTEETSEPTTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEQ 691

Query: 348 EGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMH 169
E Q S + +E+E EE+S PST + + + +T + T E+ +EP
Sbjct: 692 ESTQETSEPST-TEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETSEPST-- 744

Query: 168 TSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + + E S PS T +
Sbjct: 745 TEEESTEETSEPTTTEEESTQETSEPSTTEEE 776



Score = 41.6 bits (96), Expect = 0.036
Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ + T +E +E SE S + E + E T + +S
Sbjct: 653 EETSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEQESTQETSEPSTTEEEST 708

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
E ++P++ + +E E E S+ + ST TS+ S T E+ +EP
Sbjct: 709 EETSEPSTTEEESTE-ETSEPST-TEEESTEETSEPS-------TTEEESTEETSEPTT- 758

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S ++ S + ++E S PS T +
Sbjct: 759 -TEEESTQETSEPSTTEEESTEETSEPSTTEEE 790



Score = 41.6 bits (96), Expect = 0.036
Identities = 31/153 (20%), Positives = 60/153 (39%)
Frame = -3

Query: 531 DLAREVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSK 352
+ + T +T+E + S ++ ET + +E S S + EE+ + S+
Sbjct: 1046 ETSEPTTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSE 1105

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
+ S + EES+ + T + + + +T + T E+ +EP
Sbjct: 1106 PSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEETSEPST- 1164

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + ++E S PS T +
Sbjct: 1165 -TEEESTEETSEPSTTEEESTEETSEPSTTEEE 1196



Score = 41.6 bits (96), Expect = 0.036
Identities = 32/147 (21%), Positives = 58/147 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ Q S+ +
Sbjct: 1094 TTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEE 1153

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S + EES+ + + + + + +T + T E+ +EP T S
Sbjct: 1154 ESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTEETSEPST--TEEES 1211

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + ++E S PS T +
Sbjct: 1212 TEETSEPSTTEEESTEETSEPSTTEEE 1238



Score = 41.6 bits (96), Expect = 0.036
Identities = 42/153 (27%), Positives = 66/153 (43%), Gaps = 4/153 (2%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ + T +E +E SE S + E + E T + +S
Sbjct: 1199 EETSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEEESTEETSEPSTTEEEST 1254

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
E ++P + + +E E E S+ + ST TS+ S T E+ +EP
Sbjct: 1255 EETSEPTTTEEESTE-ETSEPST-TEQESTQETSEPS-------TTEEESTEETSEPST- 1304

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S E+ S + + E S PS T +
Sbjct: 1305 -TEEESTEETSEPTTTEEESTQETSEPSTTDEE 1336



Score = 41.2 bits (95), Expect = 0.047
Identities = 31/147 (21%), Positives = 58/147 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ + S+ +
Sbjct: 408 TTEEESTEETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEE 467

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S Q EES+ + + + + + +T + T ++ +EP T S
Sbjct: 468 ESTQETSEPTTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTQETSEPTT--TEEES 525

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + ++E S PS T +
Sbjct: 526 TEETSEPSTTEEESTEETSEPSTTEEE 552



Score = 41.2 bits (95), Expect = 0.047
Identities = 32/147 (21%), Positives = 58/147 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ Q S+ +
Sbjct: 842 TTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTQETSEPTTTEE 901

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S Q EES+ + + + + + +T + T ++ +EP T S
Sbjct: 902 ESTQETSEPTTTEEESTEETSEPSTTEEESTEETSEPSTTEEESTQETSEPST--TEEES 959

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + ++E S PS T +
Sbjct: 960 TEETSEPSTTEEESTEETSEPSTTEQE 986



Score = 41.2 bits (95), Expect = 0.047
Identities = 43/160 (26%), Positives = 69/160 (43%), Gaps = 11/160 (6%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEE----TKQHKSK 352
E T P TEE++T S+ + T +E +E SE S + E + E T + +S
Sbjct: 849 EETSEPSTTEEESTQETSEPS----TTEEESTEETSEPSTTEEESTQETSEPTTTEEEST 904

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKS-------GDTGDLLETSAADDEK 193
E ++P + + +E E E S+ + ST TS+ S +T + T E+
Sbjct: 905 QETSEPTTTEEESTE-ETSEPST-TEEESTEETSEPSTTEEESTQETSEPSTTEEESTEE 962

Query: 192 PAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
+EP T S E+ S + + E S PS T +
Sbjct: 963 TSEPST--TEEESTEETSEPSTTEQESTQETSEPSTTEEE 1000



Score = 41.2 bits (95), Expect = 0.047
Identities = 31/147 (21%), Positives = 57/147 (38%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ + S+ +
Sbjct: 926 TTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTEETSEPSTTEQ 985

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S Q EES+ + + + + + +T + T ++ +EP T S
Sbjct: 986 ESTQETSEPSTTEEESTEETSEPSTTEEESTEETSEPTTTEEESTQETSEPST--TEEES 1043

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
E+ S + + E S PS T +
Sbjct: 1044 TEETSEPTTTEEESTQETSEPSTTEEE 1070



Score = 40.4 bits (93), Expect = 0.080
Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 10/159 (6%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ + T +E +E SE S + E + E T + +S
Sbjct: 1171 EETSEPSTTEEESTEETSEPS----TTEEESTEETSEPSTTEEESTEETSEPSTTEEEST 1226

Query: 351 NEGAQPASVQNLGSEDEQV------EESSINDNPSTVSTSDKSGDTGDLLETSAADDEKP 190
E ++P++ + +E E EES+ + T + + + +T + T ++
Sbjct: 1227 EETSEPSTTEEESTE-ETSEPSTTEEESTEETSEPTTTEEESTEETSEPSTTEQESTQET 1285

Query: 189 AEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
+EP T S E+ S + ++E S P+ T +
Sbjct: 1286 SEPST--TEEESTEETSEPSTTEEESTEETSEPTTTEEE 1322



Score = 40.0 bits (92), Expect = 0.11
Identities = 30/147 (20%), Positives = 58/147 (39%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQP 334
T +TEE + S ++ ET + +E S S + EE+ + S+ +
Sbjct: 870 TTEEESTEETSEPSTTEEESTQETSEPTTTEEESTQETSEPTTTEEESTEETSEPSTTEE 929

Query: 333 ASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAAS 154
S + EES+ + + + + + +T + T E+ +EP T S
Sbjct: 930 ESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTEETSEPST--TEQES 987

Query: 153 EEDISPDVNKGADFSDEDSTPSYTSAD 73
++ S + ++E S PS T +
Sbjct: 988 TQETSEPSTTEEESTEETSEPSTTEEE 1014



Score = 39.7 bits (91), Expect = 0.14
Identities = 40/161 (24%), Positives = 68/161 (42%), Gaps = 14/161 (8%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVS----NAEGSVEETKQHKSKNE 346
T +TEE + S ++ ET + +E S + S E S EET + + E
Sbjct: 772 TTEEESTEETSEPSTTEEESTQETSEPTTTEEQSTETPSEPTTTEEESTEETSEPSTTEE 831

Query: 345 GAQPASVQNLGSEDEQVEES---SINDNPSTVSTSDKS----GDTGDLLETSAADDE--- 196
+ + + +E+E EE+ S + ST TS+ S T + E S ++E
Sbjct: 832 ESTEETSEPSTTEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETSEPSTTEEESTQ 891

Query: 195 KPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
+ +EP T S ++ S + ++E S PS T +
Sbjct: 892 ETSEPTT--TEEESTQETSEPTTTEEESTEETSEPSTTEEE 930



Score = 39.7 bits (91), Expect = 0.14
Identities = 35/161 (21%), Positives = 70/161 (43%), Gaps = 13/161 (8%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETK-----QHKS 355
E T P TEE++T S+ + T E +E SE + + E S +ET + +S
Sbjct: 1311 EETSEPTTTEEESTQETSEPS----TTDEESTEETSEPTTTEEE-STQETSEPSTTEEES 1365

Query: 354 KNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADD-------- 199
E ++P++ + +E + E++ + S S +S +T + ET+ A +
Sbjct: 1366 TEETSEPSTTEEESTEATETTETTEATESTLASESGESTETTESTETAEATESSLATESG 1425

Query: 198 EKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSA 76
E T+ A+E ++ + + + ++ T T +
Sbjct: 1426 ESTEATETTETTEATESSLATESGESTEATETTETTEATES 1466



Score = 39.3 bits (90), Expect = 0.18
Identities = 38/152 (25%), Positives = 65/152 (42%), Gaps = 5/152 (3%)
Frame = -3

Query: 513 TVAPPATEE-----KTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKN 349
T +TEE T ++ T T +E +E SE S + E S +ET + +
Sbjct: 744 TTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEETSEPSTTEEE-STQETSEPTTTE 802

Query: 348 EGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMH 169
E + + +E+E EE+S PST + + + +T + T E+ +EP
Sbjct: 803 EQSTETPSEPTTTEEESTEETS---EPST-TEEESTEETSEPSTTEEESTEETSEPST-- 856

Query: 168 TSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
T S ++ S + ++E S PS T +
Sbjct: 857 TEEESTQETSEPSTTEEESTEETSEPSTTEEE 888



Score = 37.7 bits (86), Expect = 0.52
Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 17/180 (9%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE----ETKQHKSK 352
E T P TEE++T S+ + T ++ +E SE S + E + E T + +S
Sbjct: 667 EETSEPSTTEEESTEETSEPS----TTEQESTQETSEPSTTEEESTEETSEPSTTEEEST 722

Query: 351 NEGAQPASVQNLGSEDEQV------EESSINDNPSTVSTSDKSGDTGDLLETSAADDEKP 190
E ++P++ + +E E EES+ + T + + + +T + T E+
Sbjct: 723 EETSEPSTTEEESTE-ETSEPSTTEEESTEETSEPTTTEEESTQETSEPSTTEEESTEET 781

Query: 189 AEPVVMHTSAASE-------EDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMP 31
+EP + E E+ S + ++E+ST TS ++ +E+ P
Sbjct: 782 SEPSTTEEESTQETSEPTTTEEQSTETPSEPTTTEEESTEE-TSEPSTTEEESTEETSEP 840



Score = 35.4 bits (80), Expect = 2.6
Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 11/158 (6%)
Frame = -3

Query: 513 TVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEG----SVEETKQHKSKNE 346
T P TEE++T S+ + T +E +E SE + + + S T + +S E
Sbjct: 767 TSEPSTTEEESTEETSEPS----TTEEESTQETSEPTTTEEQSTETPSEPTTTEEESTEE 822

Query: 345 GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKS-------GDTGDLLETSAADDEKPA 187
++P++ + +E E E S+ + ST TS+ S +T + T E+ +
Sbjct: 823 TSEPSTTEEESTE-ETSEPST-TEEESTEETSEPSTTEEESTQETSEPSTTEEESTEETS 880

Query: 186 EPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSAD 73
EP T S ++ S + + E S P+ T +
Sbjct: 881 EPST--TEEESTQETSEPTTTEEESTQETSEPTTTEEE 916



Score = 33.5 bits (75), Expect = 9.8
Identities = 34/148 (22%), Positives = 58/148 (39%), Gaps = 2/148 (1%)
Frame = -3

Query: 525 AREVTVAPPATEEKTTGSFSKATDVVETPQ--EVDLKENSEASVSNAEGSVEETKQHKSK 352
A EVT + A+E +G ++AT+ ET + E L S S E S+ S+
Sbjct: 2651 ATEVTESSLASE---SGESTEATETTETAEATESTLASESGESTEATESSLVTESGISSE 2707

Query: 351 NEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVM 172
E D SI P+T +T +SG++ + E++ +
Sbjct: 2708 GETTTLCPTCTPSGSDMTEATESIESTPATEAT--ESGESSNASESTVSFPTVSGSESSS 2765

Query: 171 HTSAASEEDISPDVNKGADFSDEDSTPS 88
+TS S+ + + +STP+
Sbjct: 2766 YTSGYSQSNFTESTEATESTESTESTPA 2793


>tr|A2FD98|A2FD98_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_451380 PE=4 SV=1
Length = 662

Score = 50.8 bits (120), Expect = 6e-05
Identities = 46/184 (25%), Positives = 74/184 (40%), Gaps = 12/184 (6%)
Frame = -3

Query: 519 EVTVAPPATEEKTT--GSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNE 346
E T + +TE ++T S S +T+ T SE++ S++ S T S E
Sbjct: 412 ESTTSSSSTESESTTSSSSSSSTESESTTSSSSSSTESESTTSSSTESESTTSSSSSSTE 471

Query: 345 GAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHT 166
S + + E SS + + ST S S S T E++++ +
Sbjct: 472 SESTTS-SSTSTSTESESTSSSSTSTSTESESTTSSSTSTESESTSSSSTSTESESTTSS 530

Query: 165 SAASEEDISPDVNKGADFSDEDSTPSYTSADGDNM----------KDILDESDMPDKLIS 16
S++S E S + + E +T S TS ++ KDI ESD D + +
Sbjct: 531 SSSSTESESTTSSSSSSTESESTTTSSTSTKNESTPIPPQEKTPGKDITSESDTSDLINN 590

Query: 15 EEPL 4
EE L
Sbjct: 591 EEEL 594


>tr|Q6C1J9|Q6C1J9_YARLI YALI0F15653p OS=Yarrowia lipolytica
GN=YALI0F15653g PE=4 SV=1
Length = 1051

Score = 50.8 bits (120), Expect = 6e-05
Identities = 42/174 (24%), Positives = 67/174 (38%), Gaps = 10/174 (5%)
Frame = -3

Query: 519 EVTVAPPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVE-----ETKQHKS 355
E + P +TE TT D TP+ + SE S E ++E ET + S
Sbjct: 348 EEQITPSSTEPSTT------EDPTTTPESSTIPSTSEEPTSTPESTIEPSSTPETTEPSS 401

Query: 354 KNEGAQPASVQNLGSEDEQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKP----- 190
+ P + + +E E SS ++ + ST+D T D+ + EKP
Sbjct: 402 TESSSTPVTTEPSSTEPSSTEPSSTPESTTAPSTTDDVTTTDDVTTKPESTTEKPTTDLS 461

Query: 189 AEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPD 28
+ PV S+ I P+ + + D +T T+ K D S P+
Sbjct: 462 SSPVTTEPSSTESSPI-PETTEPSTTLDVTTTNESTTPKSTTEKPTTDPSSSPE 514


>tr|Q4P120|Q4P120_USTMA Putative uncharacterized protein OS=Ustilago
maydis GN=UM06193.1 PE=4 SV=1
Length = 475

Score = 50.8 bits (120), Expect = 6e-05
Identities = 48/179 (26%), Positives = 73/179 (40%), Gaps = 12/179 (6%)
Frame = -3

Query: 507 APPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPAS 328
AP +K + KA + + +A +N +G E TK K +P
Sbjct: 12 APAVNAKKASKKDKKAAPAANVVEPKANGVDKKAKYNNKKGKKEATK----KEPTPEPEP 67

Query: 327 VQNLGSEDEQVEESSINDNPSTVSTSDKSGDTG-------DLLETSAADDEKP-----AE 184
SE E ++SS +DN + S+SD S D+ + +ET AA K A
Sbjct: 68 ESESESESESSDDSSDSDNDKSKSSSDSSSDSDSSDSSDDEQVETKAAPAAKTNGKPAAA 127

Query: 183 PVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMPDKLISEEP 7
PV +S++ D S D + ++ SD DS S +S D ++ K K E P
Sbjct: 128 PVAEASSSSDSSDDSSDSDSSSE-SDSDSDSSDSSDDDEDEKPAAAADSKKRKAEDEAP 185


>tr|A6RK10|A6RK10_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_00781
PE=4 SV=1
Length = 468

Score = 50.8 bits (120), Expect = 6e-05
Identities = 42/181 (23%), Positives = 79/181 (43%), Gaps = 21/181 (11%)
Frame = -3

Query: 507 APPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEGSVEETKQHKSKNEGAQPAS 328
A A+ E T+ S S +++ ++ E + +E S+ +++A + + T + S + + +S
Sbjct: 151 AAKASSEDTSSSSSSSSESSDSSSEEESEEESDVEMADAPPAKKNTSRRSSSSSSSSSSS 210

Query: 327 VQNLGSE--------DEQVEESSINDNPSTV---------STSDKSGDTGDLLETSAADD 199
+ S D++ + S+ +PS +TSD + D +SA D
Sbjct: 211 SSSSSSSSSSSDSDADDEDDAPSVVKSPSPKPKVNTLKRKATSDSDSSSSDSDSSSAEDA 270

Query: 198 EKPAEPVVMHT----SAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMKDILDESDMP 31
K + T SA+S E S D + +D SD DS S + + I ++ +P
Sbjct: 271 PKSKKAKTAATDKESSASSSESSSEDDSSSSDSSDSDSDSDSDSDSDSSTQSIAKKTPLP 330

Query: 30 D 28
D
Sbjct: 331 D 331



Score = 38.1 bits (87), Expect = 0.40
Identities = 38/181 (20%), Positives = 70/181 (38%), Gaps = 14/181 (7%)
Frame = -3

Query: 555 ARSLYLKRDLAREVTV---APPATEEKTTGSFSKATDVVETPQEVDLKENSEASVSNAEG 385
+R+L +R + T +P + E + + + + + +K+N + A+
Sbjct: 95 SRTLKTERRNREDATAGGTSPTTSLENIYNEWQASKEEIAALKAAAIKKNETSKPKAAKA 154

Query: 384 SVEETKQHKSKNEGAQPASVQNLGSEDEQVEESSI-----------NDNPSTVSTSDKSG 238
S E+T S + + +S + E+ VE + + + S+ S+S S
Sbjct: 155 SSEDTSSSSSSSSESSDSSSEEESEEESDVEMADAPPAKKNTSRRSSSSSSSSSSSSSSS 214

Query: 237 DTGDLLETSAADDEKPAEPVVMHTSAASEEDISPDVNKGADFSDEDSTPSYTSADGDNMK 58
+ S ADDE A VV S P VN + DS S + +D + +
Sbjct: 215 SSSSSSSDSDADDEDDAPSVVKSPSP------KPKVNTLKRKATSDSDSSSSDSDSSSAE 268

Query: 57 D 55
D
Sbjct: 269 D 269


>tr|Q0ECW6|Q0ECW6_ENTHI Serine-rich protein OS=Entamoeba histolytica
GN=SREHP PE=4 SV=1
Length = 221

Score = 50.4 bits (119), Expect = 8e-05
Identities = 47/157 (29%), Positives = 79/157 (50%), Gaps = 8/157 (5%)
Frame = -3

Query: 474 SFSKATDVV-ETPQEVDLKENSEASVSNAEGSVE--ETKQHKSKNEGAQPASVQNLGSED 304
+F+ AT+++ + QEV + N E S E E + K K+ A+P S N +ED
Sbjct: 9 AFTSATNIILDLDQEVKDTNIYGVFLKN-EASPEKLEEAEEKEKSSSAKPESSSNEDNED 67

Query: 303 EQVEESSINDNPSTVSTSDKSGDTGDLLETSAADDEKPAEPVVMHTSAASEEDIS----P 136
++ E++S +DN S S+SDK + E S++D + + S++ + ++S P
Sbjct: 68 DEDEKASSSDN-SESSSSDKPDNKP---EASSSDKPEASSSDKPEASSSDKPEVSSSDKP 123

Query: 135 DVNKGADFSDE-DSTPSYTSADGDNMKDILDESDMPD 28
D A SD+ D+ P +S+D + K SD PD
Sbjct: 124 DNKPEASSSDKPDNKPEASSSDKPDNKPEASSSDKPD 160