BP920623
Clone id YMU001_000139_D08
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGAAGCAGCAGGCGAGGTCGAGGGTACGGTACTACAGAACCCACCGCGTGCTTGCGTCAG
AAGAGGCTTGCCTGTGTCACAAGATATTTCAGTGACCTGCATATTGAATGATGAGAAAGT
AAAGGCAAAAGAGGCTAGGCCAAAGGCTGCTAGACGTCATTGAAGAGAAAGCGAGCCACA
GCATGATATAAATGCGAGACGTGCATAATTGCATGTGTAGGGATGTTGACCTCGCTGAGA
GCAGAGGAAACGATAAAGCCATCACATCCTTGAGAAGGGCCTGCGGCCATCCGGATGAGG
AGAAGAAGGAGAGAGTTGAGATACAGAGAAAAGGGTTGGTGTCAGGATCCATCAAGCCAC
ACAAGATCACATTTATTTGTGTTCTAAATGCATGCTTCTTTAAAAGAGGCAATTGCGGTT
CATGCCTCTATAATAGCTGAGTAATTTGAAGCTGACATTGTACTTGGAACTGCGCTCCTA
AACATGTATGGGACCTGTGGACAAGTGCTCTATGCAGCTAATGTTTATGACCACATGCCT
ATCTGCGATAC
■■Homology search results ■■ -
sp_hit_id Q0WVU0
Definition sp|Q0WVU0|PP278_ARATH Pentatricopeptide repeat-containing protein At3g51320 OS=Arabidopsis thaliana
Align length 50
Score (bit) 44.7
E-value 6.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920623|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_D08.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0WVU0|PP278_ARATH Pentatricopeptide repeat-containing protei... 45 6e-05
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 46 1e-04
sp|Q9FK93|PP406_ARATH Pentatricopeptide repeat-containing protei... 44 5e-04
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 44 7e-04
sp|O64766|PP185_ARATH Pentatricopeptide repeat-containing protei... 32 7e-04
sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containi... 43 9e-04
sp|Q9C501|PPR70_ARATH Pentatricopeptide repeat-containing protei... 31 0.002
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 39 0.003
sp|Q9MAT2|PPR10_ARATH Pentatricopeptide repeat-containing protei... 37 0.003
sp|P0C8Q2|PP323_ARATH Pentatricopeptide repeat-containing protei... 41 0.004
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 41 0.004
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 34 0.006
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 40 0.006
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 34 0.007
sp|Q9ZQA1|PP188_ARATH Pentatricopeptide repeat-containing protei... 33 0.012
sp|Q9LXY5|PP284_ARATH Pentatricopeptide repeat-containing protei... 39 0.013
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 39 0.013
sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protei... 39 0.013
sp|Q9LUS3|PP237_ARATH Pentatricopeptide repeat-containing protei... 35 0.016
sp|Q0WQW5|PPR85_ARATH Pentatricopeptide repeat-containing protei... 39 0.017
sp|Q9C9H9|PP114_ARATH Pentatricopeptide repeat-containing protei... 39 0.017
sp|Q9LJ69|PP243_ARATH Pentatricopeptide repeat-containing protei... 32 0.021
sp|Q9LVF9|PP245_ARATH Pentatricopeptide repeat-containing protei... 38 0.029
sp|Q9LUL5|PP229_ARATH Pentatricopeptide repeat-containing protei... 38 0.029
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 38 0.037
sp|Q9FK33|PP427_ARATH Pentatricopeptide repeat-containing protei... 38 0.037
sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protei... 38 0.037
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 34 0.044
sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protei... 37 0.049
sp|Q9MA95|PP214_ARATH Putative pentatricopeptide repeat-containi... 37 0.049

>sp|Q0WVU0|PP278_ARATH Pentatricopeptide repeat-containing protein
At3g51320 OS=Arabidopsis thaliana GN=At3g51320 PE=2 SV=1
Length = 530

Score = 44.7 bits (104), Expect(2) = 6e-05
Identities = 21/50 (42%), Positives = 32/50 (64%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPI 543
A LKE +VHAS+I + +V+ TAL++MYG C +V A ++D + I
Sbjct: 264 ARLKEGRSVHASLIRTFLNSSVVIDTALIDMYGKCKEVGLARRIFDSLSI 313



Score = 20.8 bits (42), Expect(2) = 6e-05
Identities = 10/32 (31%), Positives = 16/32 (50%)
Frame = +3

Query: 219 RDVDLAESRGNDKAITSLRRACGHPDEEKKER 314
R++ A +GN+ + L ACG K+ R
Sbjct: 239 REMVRAGFQGNESTLVLLLNACGRSARLKEGR 270


>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing
protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35
PE=3 SV=1
Length = 995

Score = 45.8 bits (107), Expect = 1e-04
Identities = 19/50 (38%), Positives = 34/50 (68%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPI 543
A+L+ + VHA + E+D+V+G+AL++MY CG++ YA ++ MP+
Sbjct: 633 ATLERGMEVHACSVRACLESDVVVGSALVDMYSKCGRLDYALRFFNTMPV 682


>sp|Q9FK93|PP406_ARATH Pentatricopeptide repeat-containing protein
At5g39680 OS=Arabidopsis thaliana GN=EMB2744 PE=2 SV=1
Length = 710

Score = 43.9 bits (102), Expect = 5e-04
Identities = 23/55 (41%), Positives = 33/55 (60%)
Frame = +1

Query: 367 SHLFVF*MHASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYD 531
S L +F L A+ VH+ ++ F A++ AL+NMYG CG+VLYA V+D
Sbjct: 242 SSLRLFSNLRDLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFD 296


>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein
At3g24000, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H87 PE=2 SV=1
Length = 633

Score = 43.5 bits (101), Expect = 7e-04
Identities = 20/41 (48%), Positives = 25/41 (60%)
Frame = +1

Query: 418 VHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
VHA I+ F DIV+G LLNMY CG + A V++ MP
Sbjct: 82 VHAHILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMP 122


>sp|O64766|PP185_ARATH Pentatricopeptide repeat-containing protein
At2g35030, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E15 PE=2 SV=1
Length = 627

Score = 31.6 bits (70), Expect(2) = 7e-04
Identities = 15/51 (29%), Positives = 28/51 (54%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPIC 546
A L E +H I + + ++ +ALLNMY G+++ A ++D+ +C
Sbjct: 345 AGLVEGQQIHQLISKSVHQKNEIVTSALLNMYSKSGELIAARKMFDNGLVC 395



Score = 30.0 bits (66), Expect(2) = 7e-04
Identities = 12/34 (35%), Positives = 23/34 (67%)
Frame = +3

Query: 294 DEEKKERVEIQRKGLVSGSIKPHKITFICVLNAC 395
++E +E + + K L GS+KP+ T++ +L+AC
Sbjct: 308 NKENEEALNVFSKMLRDGSVKPNVGTYVSILSAC 341


>sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containing
protein At5g52630 OS=Arabidopsis thaliana GN=PCMP-H52
PE=3 SV=1
Length = 588

Score = 43.1 bits (100), Expect = 9e-04
Identities = 15/42 (35%), Positives = 30/42 (71%)
Frame = +1

Query: 415 AVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+VH + ++AD+ +G++L++MY CG+++YA ++D MP
Sbjct: 137 SVHCLSMKTGYDADVFVGSSLVDMYAKCGEIVYARKMFDEMP 178


>sp|Q9C501|PPR70_ARATH Pentatricopeptide repeat-containing protein
At1g33350 OS=Arabidopsis thaliana GN=PCMP-E57 PE=2 SV=1
Length = 538

Score = 30.8 bits (68), Expect(2) = 0.002
Identities = 12/29 (41%), Positives = 21/29 (72%)
Frame = +3

Query: 309 ERVEIQRKGLVSGSIKPHKITFICVLNAC 395
E V + R+ + SI+P+++T +CVL+AC
Sbjct: 242 EAVSLFRRMINEPSIRPNEVTVVCVLSAC 270



Score = 29.6 bits (65), Expect(2) = 0.002
Identities = 12/44 (27%), Positives = 26/44 (59%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVY 528
+L+ A +HA +D+ + +L+++YG CG + A++V+
Sbjct: 275 TLQLAKGIHAFAYRRDLSSDVFVSNSLVDLYGKCGNLEEASSVF 318


>sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protein
At4g25270, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-E53 PE=2 SV=1
Length = 527

Score = 38.5 bits (88), Expect(2) = 0.003
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = +1

Query: 415 AVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
A+H ++ E F D+ + AL+ MY CG ++ A NV+D +P
Sbjct: 216 AIHRDLVKEGFGYDVYVLNALVVMYAKCGDIVKARNVFDMIP 257



Score = 21.2 bits (43), Expect(2) = 0.003
Identities = 8/20 (40%), Positives = 11/20 (55%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNAC 395
+ +KP + TF VL AC
Sbjct: 186 MAEDGVKPDRFTFPRVLKAC 205


>sp|Q9MAT2|PPR10_ARATH Pentatricopeptide repeat-containing protein
At1g04840 OS=Arabidopsis thaliana GN=PCMP-H64 PE=2 SV=1
Length = 665

Score = 37.4 bits (85), Expect(2) = 0.003
Identities = 17/47 (36%), Positives = 28/47 (59%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
+L I +H I+ + D +GTAL++MY CG++ AA V+ +M
Sbjct: 308 ALGSGIRIHGYILDNGIKLDRAIGTALVDMYAKCGELDCAATVFSNM 354



Score = 21.9 bits (45), Expect(2) = 0.003
Identities = 11/29 (37%), Positives = 17/29 (58%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNACFFKRGNCGS 422
++ +KP++ T VL+AC K G GS
Sbjct: 284 MLEKGLKPNEYTIAAVLSAC-SKSGALGS 311


>sp|P0C8Q2|PP323_ARATH Pentatricopeptide repeat-containing protein
At4g19191, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E1 PE=2 SV=1
Length = 654

Score = 40.8 bits (94), Expect = 0.004
Identities = 18/41 (43%), Positives = 27/41 (65%)
Frame = +1

Query: 418 VHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
VHA +I F +D+ +GTA ++M+ C V YAA V++ MP
Sbjct: 74 VHAHLIKSPFWSDVFVGTATVDMFVKCNSVDYAAKVFERMP 114


tr_hit_id A9SQ58
Definition tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 48
Score (bit) 43.5
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920623|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_D08.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 44 3e-05
tr|A7PXL1|A7PXL1_VITVI Chromosome chr12 scaffold_36, whole genom... 46 4e-05
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 39 1e-04
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 48 4e-04
tr|A7Q306|A7Q306_VITVI Chromosome chr12 scaffold_47, whole genom... 47 9e-04
tr|A5AWQ4|A5AWQ4_VITVI Putative uncharacterized protein OS=Vitis... 47 9e-04
tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 38 0.001
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 38 0.001
tr|B7U9V0|B7U9V0_CARAS AT5G09950-like protein OS=Cardaminopsis a... 46 0.001
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 41 0.002
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 41 0.002
tr|A9PHW8|A9PHW8_POPTR Putative uncharacterized protein OS=Popul... 39 0.002
tr|A7PDG9|A7PDG9_VITVI Chromosome chr17 scaffold_12, whole genom... 45 0.002
tr|A7QGW1|A7QGW1_VITVI Chromosome chr16 scaffold_94, whole genom... 40 0.003
tr|A9S537|A9S537_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.004
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.006
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.006
tr|A7PWD6|A7PWD6_VITVI Chromosome chr8 scaffold_34, whole genome... 43 0.006
tr|Q8LI18|Q8LI18_ORYSJ Selenium-binding protein-like OS=Oryza sa... 44 0.006
tr|Q10S36|Q10S36_ORYSJ Pentatricopeptide, putative, expressed (P... 44 0.006
tr|Q0D563|Q0D563_ORYSJ Os07g0578800 protein OS=Oryza sativa subs... 44 0.006
tr|A3BLI2|A3BLI2_ORYSJ Putative uncharacterized protein OS=Oryza... 44 0.006
tr|A2XC93|A2XC93_ORYSI Putative uncharacterized protein OS=Oryza... 44 0.007
tr|Q94DX0|Q94DX0_ORYSJ Pentatricopeptide (PPR) repeat protein-li... 43 0.010
tr|B8AA43|B8AA43_ORYSI Putative uncharacterized protein OS=Oryza... 43 0.010
tr|A7QUT6|A7QUT6_VITVI Chromosome chr1 scaffold_180, whole genom... 43 0.010
tr|A7PXE6|A7PXE6_VITVI Chromosome chr12 scaffold_36, whole genom... 43 0.010
tr|A5AI35|A5AI35_VITVI Putative uncharacterized protein OS=Vitis... 43 0.010
tr|A2Q3L7|A2Q3L7_MEDTR Tetratricopeptide-like helical OS=Medicag... 43 0.010
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 34 0.012

>tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133419 PE=4 SV=1
Length = 505

Score = 43.5 bits (101), Expect(2) = 3e-05
Identities = 19/48 (39%), Positives = 31/48 (64%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
SL++ +H+ I+ FE D+ +GTAL+NM+ CG V+ A V+ +P
Sbjct: 263 SLEQGTLLHSVIMKAGFELDVRVGTALVNMFSKCGSVVDALKVFQKLP 310



Score = 27.3 bits (59), Expect(2) = 3e-05
Identities = 10/22 (45%), Positives = 15/22 (68%)
Frame = +3

Query: 330 KGLVSGSIKPHKITFICVLNAC 395
K ++ KP K+T+I +LNAC
Sbjct: 240 KAMLDEGQKPDKVTYISILNAC 261



Score = 37.0 bits (84), Expect = 0.69
Identities = 16/47 (34%), Positives = 26/47 (55%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
SL++ + VH ++ DI+LG L++MY CG + A V+ M
Sbjct: 165 SLEKGMKVHQDMVRGGIRPDIILGNTLIDMYAKCGNLKQAHRVFKEM 211


>tr|A7PXL1|A7PXL1_VITVI Chromosome chr12 scaffold_36, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026082001
PE=4 SV=1
Length = 723

Score = 46.2 bits (108), Expect(2) = 4e-05
Identities = 17/49 (34%), Positives = 35/49 (71%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
A+L+ +++H+ ++ + F+A+ ++GTAL++MY CG + + V+D MP
Sbjct: 365 AALRYGMSIHSYLVKKGFDANTIVGTALVDMYSKCGSLACSRRVFDEMP 413



Score = 23.9 bits (50), Expect(2) = 4e-05
Identities = 12/29 (41%), Positives = 18/29 (62%)
Frame = +3

Query: 309 ERVEIQRKGLVSGSIKPHKITFICVLNAC 395
E + + R+ + GS P ++TFI VL AC
Sbjct: 334 ESLRLFRRMALDGS-GPDQVTFIAVLGAC 361


>tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_116111 PE=4 SV=1
Length = 437

Score = 39.3 bits (90), Expect(2) = 1e-04
Identities = 18/49 (36%), Positives = 30/49 (61%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+SL++ +H+ II E D+ +GTALLNMY C + A +++ +P
Sbjct: 188 SSLEQGRILHSYIIEAGLELDLWVGTALLNMYSNCRSLEDALQIFEKLP 236



Score = 29.3 bits (64), Expect(2) = 1e-04
Identities = 9/15 (60%), Positives = 13/15 (86%)
Frame = +3

Query: 351 IKPHKITFICVLNAC 395
+KP K+T++CVLN C
Sbjct: 173 LKPDKVTYVCVLNVC 187


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 47.8 bits (112), Expect = 4e-04
Identities = 22/49 (44%), Positives = 31/49 (63%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+ L+ VH IIA FE+D+++GTAL +MY CG + A V+D MP
Sbjct: 134 SDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMP 182



Score = 40.8 bits (94), Expect = 0.048
Identities = 21/58 (36%), Positives = 33/58 (56%)
Frame = +1

Query: 367 SHLFVF*MHASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+HLF +L++ +H I FE++ V+G AL+NMY CG V A +++ MP
Sbjct: 333 AHLF------ALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMP 384



Score = 39.7 bits (91), Expect = 0.11
Identities = 16/48 (33%), Positives = 30/48 (62%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+L++ +H I FE+++V+GT L+++Y CG V A +++ MP
Sbjct: 438 ALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMP 485



Score = 38.5 bits (88), Expect = 0.24
Identities = 17/51 (33%), Positives = 29/51 (56%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPICD 549
+L++ +H I E+D+++ L+NMY CG V A +++ MPI D
Sbjct: 236 ALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRD 286


>tr|A7Q306|A7Q306_VITVI Chromosome chr12 scaffold_47, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029102001
PE=4 SV=1
Length = 978

Score = 46.6 bits (109), Expect = 9e-04
Identities = 20/50 (40%), Positives = 35/50 (70%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPI 543
A+L+ + VHA I E+D+V+G+AL++MY CG++ YA+ ++ MP+
Sbjct: 625 ATLERGMEVHACGIRACLESDVVVGSALVDMYSKCGRIDYASRFFELMPL 674


>tr|A5AWQ4|A5AWQ4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024322 PE=4 SV=1
Length = 1539

Score = 46.6 bits (109), Expect = 9e-04
Identities = 20/50 (40%), Positives = 35/50 (70%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPI 543
A+L+ + VHA I E+D+V+G+AL++MY CG++ YA+ ++ MP+
Sbjct: 1179 ATLERGMEVHACGIRACMESDVVVGSALVDMYSKCGRIDYASRFFELMPL 1228


>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 35.4 bits (80), Expect(2) = 0.001
Identities = 14/35 (40%), Positives = 24/35 (68%)
Frame = +1

Query: 445 FEADIVLGTALLNMYGTCGQVLYAANVYDHMPICD 549
++ D+ +GTAL+NM+ CG + A V+D++P D
Sbjct: 242 WDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRD 276



Score = 29.6 bits (65), Expect(2) = 0.001
Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNACFFKRG-NCGSCLYN 434
+V S+KP K TF+ +LNAC R + G LYN
Sbjct: 202 MVQDSVKPDKRTFVSMLNACADARNVDKGRELYN 235



Score = 38.1 bits (87), Expect(2) = 0.002
Identities = 17/48 (35%), Positives = 28/48 (58%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+L E +HA I F+ D+++GT L++MY CG + A V+ +P
Sbjct: 630 ALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLP 677



Score = 26.6 bits (57), Expect(2) = 0.002
Identities = 12/22 (54%), Positives = 14/22 (63%)
Frame = +3

Query: 330 KGLVSGSIKPHKITFICVLNAC 395
K + IKP KITF +LNAC
Sbjct: 604 KMMQESGIKPDKITFTGLLNAC 625



Score = 33.5 bits (75), Expect(2) = 0.20
Identities = 14/41 (34%), Positives = 26/41 (63%)
Frame = +1

Query: 418 VHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
VH I+ E+D+ + AL++M+ CG ++ A N+++ MP
Sbjct: 536 VHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMP 576



Score = 23.9 bits (50), Expect(2) = 0.20
Identities = 9/22 (40%), Positives = 13/22 (59%)
Frame = +3

Query: 330 KGLVSGSIKPHKITFICVLNAC 395
+ L+ IKP+ TF +LN C
Sbjct: 503 QALLKEGIKPNSSTFTSILNVC 524



Score = 28.1 bits (61), Expect(2) = 2.5
Identities = 15/46 (32%), Positives = 25/46 (54%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYD 531
++LK + II + +D + TALL+MY CG + A V++
Sbjct: 427 SALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFE 472



Score = 25.4 bits (54), Expect(2) = 2.5
Identities = 7/20 (35%), Positives = 15/20 (75%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNAC 395
++ I+P+++TF+ +L AC
Sbjct: 404 MIESGIEPNRVTFMSILGAC 423



Score = 33.9 bits (76), Expect = 5.9
Identities = 16/45 (35%), Positives = 28/45 (62%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYD 531
+L++ VHA + ++ +I +GTA+L+MY CG + A V+D
Sbjct: 327 ALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFD 371


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 35.4 bits (80), Expect(2) = 0.001
Identities = 14/35 (40%), Positives = 24/35 (68%)
Frame = +1

Query: 445 FEADIVLGTALLNMYGTCGQVLYAANVYDHMPICD 549
++ D+ +GTAL+NM+ CG + A V+D++P D
Sbjct: 242 WDTDLFVGTALINMHIKCGDIGDATKVFDNLPTRD 276



Score = 29.6 bits (65), Expect(2) = 0.001
Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNACFFKRG-NCGSCLYN 434
+V S+KP K TF+ +LNAC R + G LYN
Sbjct: 202 MVQDSVKPDKRTFVSMLNACADARNVDKGRELYN 235



Score = 38.1 bits (87), Expect(2) = 0.002
Identities = 17/48 (35%), Positives = 28/48 (58%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
+L E +HA I F+ D+++GT L++MY CG + A V+ +P
Sbjct: 630 ALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKLP 677



Score = 26.6 bits (57), Expect(2) = 0.002
Identities = 12/22 (54%), Positives = 14/22 (63%)
Frame = +3

Query: 330 KGLVSGSIKPHKITFICVLNAC 395
K + IKP KITF +LNAC
Sbjct: 604 KMMQESGIKPDKITFTGLLNAC 625



Score = 33.5 bits (75), Expect(2) = 0.20
Identities = 14/41 (34%), Positives = 26/41 (63%)
Frame = +1

Query: 418 VHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMP 540
VH I+ E+D+ + AL++M+ CG ++ A N+++ MP
Sbjct: 536 VHFLIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMP 576



Score = 23.9 bits (50), Expect(2) = 0.20
Identities = 9/22 (40%), Positives = 13/22 (59%)
Frame = +3

Query: 330 KGLVSGSIKPHKITFICVLNAC 395
+ L+ IKP+ TF +LN C
Sbjct: 503 QALLKEGIKPNSSTFTSILNVC 524



Score = 28.1 bits (61), Expect(2) = 2.5
Identities = 15/46 (32%), Positives = 25/46 (54%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYD 531
++LK + II + +D + TALL+MY CG + A V++
Sbjct: 427 SALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFE 472



Score = 25.4 bits (54), Expect(2) = 2.5
Identities = 7/20 (35%), Positives = 15/20 (75%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNAC 395
++ I+P+++TF+ +L AC
Sbjct: 404 MIESGIEPNRVTFMSILGAC 423



Score = 33.9 bits (76), Expect = 5.9
Identities = 16/45 (35%), Positives = 28/45 (62%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYD 531
+L++ VHA + ++ +I +GTA+L+MY CG + A V+D
Sbjct: 327 ALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVFD 371


>tr|B7U9V0|B7U9V0_CARAS AT5G09950-like protein OS=Cardaminopsis
arenosa PE=4 SV=1
Length = 772

Score = 45.8 bits (107), Expect = 0.001
Identities = 19/50 (38%), Positives = 34/50 (68%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHMPI 543
A+L+ + VHA + E+D+V+G+AL++MY CG++ YA ++ MP+
Sbjct: 353 ATLERGMEVHACSVRACLESDVVVGSALVDMYSKCGRLDYALRFFNTMPV 402


>tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1
Length = 868

Score = 39.3 bits (90), Expect(2) = 0.002
Identities = 18/49 (36%), Positives = 26/49 (53%)
Frame = +1

Query: 391 HASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
H +L++ +HA + FE D L TA+ NMY CG + A V+ M
Sbjct: 377 HGALEQGRQIHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVFSKM 425



Score = 25.4 bits (54), Expect(2) = 0.002
Identities = 11/37 (29%), Positives = 21/37 (56%)
Frame = +3

Query: 285 GHPDEEKKERVEIQRKGLVSGSIKPHKITFICVLNAC 395
G+ D+E + V + + + P+K+TF+ +L AC
Sbjct: 338 GYKDKESIDEVFQLLERMRREGVFPNKVTFMSILRAC 374



Score = 36.2 bits (82), Expect(2) = 0.012
Identities = 15/49 (30%), Positives = 27/49 (55%)
Frame = +1

Query: 391 HASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
++ L++ +H + A E D+ + TAL+ MY CG++ A V+ M
Sbjct: 170 YSILEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVACEVFHKM 218



Score = 25.4 bits (54), Expect(2) = 0.012
Identities = 8/20 (40%), Positives = 15/20 (75%)
Frame = +3

Query: 336 LVSGSIKPHKITFICVLNAC 395
+ +I+P++ITF+ +L AC
Sbjct: 148 MTDANIEPNRITFLSILKAC 167



Score = 41.2 bits (95), Expect = 0.037
Identities = 20/48 (41%), Positives = 27/48 (56%)
Frame = +1

Query: 394 ASLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
A L+ VHA + E+D V+ T+L+ MY CGQV A V+D M
Sbjct: 510 AGLERGKLVHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKM 557



Score = 32.3 bits (72), Expect(2) = 0.26
Identities = 14/47 (29%), Positives = 23/47 (48%)
Frame = +1

Query: 397 SLKEAIAVHASIIAE*FEADIVLGTALLNMYGTCGQVLYAANVYDHM 537
+L +H+ I E D+++ AL+ MY C V A ++D M
Sbjct: 273 ALNRGRRIHSHISERGLETDMIVANALITMYCKCNSVQEAREIFDRM 319



Score = 24.6 bits (52), Expect(2) = 0.26
Identities = 11/29 (37%), Positives = 19/29 (65%)
Frame = +3

Query: 309 ERVEIQRKGLVSGSIKPHKITFICVLNAC 395
E E+ + L +G I P+ +TF+ +LN+C
Sbjct: 241 EAFELYEQMLQAG-ISPNAVTFVSLLNSC 268