BP920630
Clone id YMU001_000139_E03
Library
Length 504
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_E03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATATGGCCATGTGGGATGCAGAGATCAAGAAAGGAAGGTGGAAGGTTTCAAAGTGCAAC
CATGATGCGATCAAAGAAAATGTTGAGAGGATTTATTTGAAAGTTTATGGCCATCCCATG
CACAATGCAGATTGTGCGCTATTTTTTGCAAAAATGTTATATGTTCACTTTGTGCAATAG
CAACCAATAGATTTCTCATCAAAGGAGAGAACTGTTGCCACTCATAATTTAAGGGAGGGT
TGTGTTACTTTCACCCGAGATGAGCTGGCATTGATAGTGGAAGGAACCGACCTACATGTA
AAGAATGTGTGCGTATGTCGCACATGTCAATGCAAGGAGCTTGCTAATACACTGTGTGCG
AGCCACAAATGGCTCCAAGCACACAACCAGCATAAACTAGTAAGCTCAAAGAAGGCGTTG
GTGTGTCACTCACCGCTCTACGCTTCCTGTTGTGGAGGATTCCTCGCCACGAAGAAGAGG
GAAACGCCGCTACGCCGCGCTCAA
■■Homology search results ■■ -
sp_hit_id Q891D3
Definition sp|Q891D3|SYY_CLOTE Tyrosyl-tRNA synthetase OS=Clostridium tetani
Align length 28
Score (bit) 30.4
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920630|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_E03.
(504 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q891D3|SYY_CLOTE Tyrosyl-tRNA synthetase OS=Clostridium tetan... 30 4.9
sp|P19055|NIFE_RHOCA Nitrogenase iron-molybdenum cofactor biosyn... 30 4.9
sp|Q00PJ9|CAV1_ATEAB Caveolin-1 OS=Atelerix albiventris GN=CAV1 ... 30 6.5

>sp|Q891D3|SYY_CLOTE Tyrosyl-tRNA synthetase OS=Clostridium tetani
GN=tyrS PE=3 SV=2
Length = 407

Score = 30.4 bits (67), Expect = 4.9
Identities = 14/28 (50%), Positives = 16/28 (57%)
Frame = -3

Query: 319 DIRTHSLHVGRFLPLSMPAHLG*K*HNP 236
D SLH+G FLPL M AH+ H P
Sbjct: 40 DPTADSLHIGHFLPLMMMAHMQKAGHRP 67


>sp|P19055|NIFE_RHOCA Nitrogenase iron-molybdenum cofactor
biosynthesis protein nifE OS=Rhodobacter capsulatus
GN=nifE PE=3 SV=1
Length = 477

Score = 30.4 bits (67), Expect = 4.9
Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 7/47 (14%)
Frame = -3

Query: 448 RKRRAVSDTPTPSLSLLVYAGCV-------LGAICGSHTVY*QAPCI 329
R R V + +P+ ++ VYA CV LGA+CG+ T APC+
Sbjct: 113 RALRPVIEAESPA-AVFVYATCVTALIGDDLGAVCGAATAKWGAPCV 158


>sp|Q00PJ9|CAV1_ATEAB Caveolin-1 OS=Atelerix albiventris GN=CAV1
PE=3 SV=1
Length = 178

Score = 30.0 bits (66), Expect = 6.5
Identities = 12/39 (30%), Positives = 24/39 (61%)
Frame = -1

Query: 402 Y*FMLVVCLEPFVARTQCISKLLALTCATYAHILYM*VG 286
Y + +V C++ F+ + QCIS++ ++ T+ LY +G
Sbjct: 126 YIWAVVPCIKSFLIKIQCISRIYSICIHTFCDPLYEAIG 164


tr_hit_id B7FLJ4
Definition tr|B7FLJ4|B7FLJ4_MEDTR Putative uncharacterized protein OS=Medicago truncatula
Align length 66
Score (bit) 35.4
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920630|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_E03.
(504 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7FLJ4|B7FLJ4_MEDTR Putative uncharacterized protein OS=Medic... 35 1.5
tr|Q22UG1|Q22UG1_TETTH Putative uncharacterized protein OS=Tetra... 35 1.5
tr|Q22UF9|Q22UF9_TETTH Putative uncharacterized protein OS=Tetra... 35 1.5
tr|Q228R9|Q228R9_TETTH Putative uncharacterized protein OS=Tetra... 35 1.5
tr|B6HWD0|B6HWD0_PENCH Putative uncharacterized protein Pc23g008... 34 3.5
tr|Q4ZZ12|Q4ZZ12_PSEU2 Oxidoreductase, FAD-binding OS=Pseudomona... 33 6.0
tr|Q24F52|Q24F52_TETTH AN1-like Zinc finger family protein OS=Te... 33 6.0
tr|Q23JT8|Q23JT8_TETTH Putative uncharacterized protein OS=Tetra... 33 9.9

>tr|B7FLJ4|B7FLJ4_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 440

Score = 35.4 bits (80), Expect = 1.5
Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 15/66 (22%)
Frame = -3

Query: 229 NYEWQQF---------------SPLMRNLLVAIAQSEHITFLQKIAHNLHCAWDGHKLSN 95
NYEW++F +P M L + + + +T Q +AH L +W G+ ++N
Sbjct: 87 NYEWERFDLLVLPPSFPYGGMENPRMVFLTPTVIKGD-VTGAQVVAHELAHSWTGNLITN 145

Query: 94 KSSQHF 77
K+++HF
Sbjct: 146 KTNEHF 151


>tr|Q22UG1|Q22UG1_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00554640 PE=4
SV=1
Length = 1411

Score = 35.4 bits (80), Expect = 1.5
Identities = 13/40 (32%), Positives = 22/40 (55%)
Frame = +3

Query: 96 FESLWPSHAQCRLCAIFCKNVICSLCAIATNRFLIKGENC 215
+E +P H C++C I + CSLC+ T +F + +C
Sbjct: 1218 YEDQFPCHFSCQICTIPNSSTACSLCSSPTRQFNLTDSSC 1257


>tr|Q22UF9|Q22UF9_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00555650 PE=4
SV=1
Length = 598

Score = 35.4 bits (80), Expect = 1.5
Identities = 13/40 (32%), Positives = 22/40 (55%)
Frame = +3

Query: 96 FESLWPSHAQCRLCAIFCKNVICSLCAIATNRFLIKGENC 215
+E +P H C++C I + CSLC+ T +F + +C
Sbjct: 405 YEDQFPCHFSCQICTIPNSSTACSLCSSPTRQFNLTDSSC 444


>tr|Q228R9|Q228R9_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01503050 PE=4
SV=1
Length = 640

Score = 35.4 bits (80), Expect = 1.5
Identities = 13/40 (32%), Positives = 22/40 (55%)
Frame = +3

Query: 96 FESLWPSHAQCRLCAIFCKNVICSLCAIATNRFLIKGENC 215
+E +P H C++C I + CSLC+ T +F + +C
Sbjct: 336 YEDQFPCHFSCQICTIPNSSTACSLCSSPTRQFNLTDSSC 375


>tr|B6HWD0|B6HWD0_PENCH Putative uncharacterized protein Pc23g00800
OS=Penicillium chrysogenum Wisconsin 54-1255
GN=Pc23g00800 PE=4 SV=1
Length = 338

Score = 34.3 bits (77), Expect = 3.5
Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 12/86 (13%)
Frame = +1

Query: 226 NLREGCVTFTRDELALIVEGTDLH----------VKNVCVCRTCQCKELANTLCASHKWL 375
N+ G + T +L L E D+H + N CV CQCK L++ CA +WL
Sbjct: 162 NIWAGIQSLTLKDLTLSDEVDDIHCVFCLAEDEDLANECVILRCQCKALSHLACA-EEWL 220

Query: 376 QAHNQHKLVSSKKALVCHS--PLYAS 447
+ + V VC + PL AS
Sbjct: 221 E---KRSTVFGTSCCVCRNEGPLDAS 243


>tr|Q4ZZ12|Q4ZZ12_PSEU2 Oxidoreductase, FAD-binding OS=Pseudomonas
syringae pv. syringae (strain B728a) GN=Psyr_0540 PE=4
SV=1
Length = 391

Score = 33.5 bits (75), Expect = 6.0
Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
Frame = +1

Query: 250 FTRDEL-ALIVEGTDLHVKNVCVCRTCQCKELANTLCASHKWLQAHNQHKLVSSKKALVC 426
F DEL L V+G D+H + + + +L N L S +Q H ++ L
Sbjct: 181 FEGDELIGLRVDGRDIHAQRIVLSAGGGNADLLNALGVSQPQMQRRPLHMVLVKGPTL-- 238

Query: 427 HSPLYASCCGG 459
PLYA C GG
Sbjct: 239 -KPLYAHCLGG 248


>tr|Q24F52|Q24F52_TETTH AN1-like Zinc finger family protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01129730 PE=4
SV=1
Length = 169

Score = 33.5 bits (75), Expect = 6.0
Identities = 15/42 (35%), Positives = 21/42 (50%)
Frame = +1

Query: 328 QCKELANTLCASHKWLQAHNQHKLVSSKKALVCHSPLYASCC 453
QC E C +H++ Q HN KL + KK + H+ A C
Sbjct: 21 QCSECNKNFCQNHRYQQDHNCEKLHAQKKEIDIHNAHKAPKC 62


>tr|Q23JT8|Q23JT8_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00860500 PE=4
SV=1
Length = 1780

Score = 32.7 bits (73), Expect = 9.9
Identities = 23/84 (27%), Positives = 32/84 (38%), Gaps = 6/84 (7%)
Frame = +3

Query: 111 PSHAQCRLCAIFCKNVICSLCAIATNRFLIKGENCCHS*FKGGLCYFHPR*AGIDSGRN- 287
P A C C+ N+ CS CA +KG+N C+ K Y P + +N
Sbjct: 318 PCMANCNSCS---DNITCSSCATGYTYAFVKGQNQCYPSCKQPAQYIDPNGVCQNCIQNC 374

Query: 288 -----RPTCKECVRMSHMSMQGAC 344
TC C + +MQ C
Sbjct: 375 SQCSQANTCDVCQQNYMKTMQNTC 398