BP920633
Clone id YMU001_000139_E07
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_E07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATCATGAGGCCTGCTCCTTCGAAAAATCGCACAGCATTCTCATTAAATTTTCATATGCAG
CAAGCTCGACCATCTCTCAGTGAGGTGCTTTCGATTGCTCAGCTACAGACTCTGGGCCTC
ACAGCATTGGTTGATGCAGATTTACCTGATACGGTTCTAGCAGAGCTGATACATCAACTG
TTGAAAGACTTTCCAAAGGTCTGGGGCCACAAGCTAACAGCTACAAGGCTTGGCCATGCC
ATGGGTATGACCAACTTTCCAGCTGTGAAGTATACTACTCGCACTTTCTCTTTGCTGTCC
AAGGATGCGACAATTCAAGCATGTCAAGAGCTATTGAGTACGGATCACCCGGATAATGAG
CGAAACAGACGCCTTCTCGCAATCTTCAGTGTATTACTTTCTGGCTCGAGATGCCAAAGA
AGACAAGGAAAAAAATGATCTTCTCACTACATTCTCCCACTGCGACGGGCTATACTGTTT
AATCCACACTATCCCTTGTGGATTCCACCAAATTCTCTTCAGTTCTTTGCAGTCTAGGG
■■Homology search results ■■ -
sp_hit_id A6Q1M4
Definition sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2)
Align length 40
Score (bit) 32.0
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920633|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_E07.
(539 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' O... 32 2.0
sp|Q17DK2|PSDIN_AEDAE Phagocyte signaling-impaired protein OS=Ae... 31 3.4
sp|Q20958|NAS29_CAEEL Zinc metalloproteinase nas-29 OS=Caenorhab... 31 3.4
sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein ... 30 5.7
sp|P08912|ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Hom... 30 5.7
sp|A0LQP0|SFSA_SYNFM Sugar fermentation stimulation protein homo... 30 9.8
sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase s... 30 9.8

>sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta'
OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1
Length = 1507

Score = 32.0 bits (71), Expect = 2.0
Identities = 15/40 (37%), Positives = 23/40 (57%)
Frame = -1

Query: 308 ASLDSKEKVRVVYFTAGKLVIPMAWPSLVAVSLWPQTFGK 189
A + +K +V+Y TAG+L+I P V V+LW + K
Sbjct: 556 AKIRTKIDNQVIYTTAGRLIIKSILPDFVPVNLWNKVLKK 595


>sp|Q17DK2|PSDIN_AEDAE Phagocyte signaling-impaired protein OS=Aedes
aegypti GN=psidin PE=3 SV=2
Length = 940

Score = 31.2 bits (69), Expect = 3.4
Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 4/124 (3%)
Frame = -2

Query: 370 VCFAHYPGDPYSIALDMLELSHPWTAKRKC--E*YTSQLESWSY--PWHGQAL*LLACGP 203
VC YPG P+SI +D+L+ + W K + T + W Y + + ++ C
Sbjct: 220 VCTNLYPGAPHSIKIDLLKKLNKWADLNKLMKQLLTEDPDRWDYYQDYILSTIEMIKCKD 279

Query: 202 RPLESLSTVDVSALLEPYQVNLHQPML*GPESVAEQSKAPH*EMVELAAYENLMRMLCDF 23
E+ TVD+ H+ + ES +++ P+ +ELA + + F
Sbjct: 280 ETPETDHTVDM----------CHEFIAGIIESQPRKNRGPYLARLELAR----LMVKHKF 325

Query: 22 SKEQ 11
KEQ
Sbjct: 326 DKEQ 329


>sp|Q20958|NAS29_CAEEL Zinc metalloproteinase nas-29
OS=Caenorhabditis elegans GN=nas-29 PE=2 SV=4
Length = 532

Score = 31.2 bits (69), Expect = 3.4
Identities = 18/61 (29%), Positives = 28/61 (45%)
Frame = +2

Query: 293 CCPRMRQFKHVKSY*VRITRIMSETDAFSQSSVYYFLARDAKEDKEKNDLLTTFSHCDGL 472
CCP + K + + + S+ FS S Y F++ A D EKND + DG+
Sbjct: 456 CCPESSRRKVISEGNMVPFMVFSKEHDFSVSFEYSFVSTSAGFDDEKNDSDVIVDNLDGV 515

Query: 473 Y 475
+
Sbjct: 516 F 516


>sp|Q6C457|UTP10_YARLI U3 small nucleolar RNA-associated protein 10
OS=Yarrowia lipolytica GN=UTP10 PE=3 SV=1
Length = 1635

Score = 30.4 bits (67), Expect = 5.7
Identities = 30/138 (21%), Positives = 55/138 (39%), Gaps = 5/138 (3%)
Frame = +1

Query: 16 PSKNRTAFSLNFHMQQARPSL-----SEVLSIAQLQTLGLTALVDADLPDTVLAELIHQL 180
P ++ F + +Q+ S+ ++ +A L+ L + + L +L+ L
Sbjct: 1442 PERSTLLFKIVCRLQENLKSIVTSYYGYIIDLA-LEILNKASAITPALQRNILSSLYSSF 1500

Query: 181 LKDFPKVWGHKLTATRLGHAMGMTNFPAVKYTTRTFSLLSKDATIQACQELLSTDHPDNE 360
D + W ++ T++ A+G FP + S L A + C EL S D
Sbjct: 1501 RFDREEFWNNEERFTKISDALG-AQFPYLTKVAPENSKLLIKAVVALC-ELASEDQKKQL 1558

Query: 361 RNRRLLAIFSVLLSGSRC 414
+ + + L GSRC
Sbjct: 1559 NDMMIKLLRQAPLYGSRC 1576


>sp|P08912|ACM5_HUMAN Muscarinic acetylcholine receptor M5 OS=Homo
sapiens GN=CHRM5 PE=2 SV=2
Length = 532

Score = 30.4 bits (67), Expect = 5.7
Identities = 18/44 (40%), Positives = 24/44 (54%)
Frame = +3

Query: 150 YGSSRADTSTVERLSKGLGPQANSYKAWPCHGYDQLSSCEVYYS 281
+ SSR TST + S+ GP AN KA +QL++C Y S
Sbjct: 271 WSSSRRSTSTTGKPSQATGPSANWAKA------EQLTTCSSYPS 308


>sp|A0LQP0|SFSA_SYNFM Sugar fermentation stimulation protein homolog
OS=Syntrophobacter fumaroxidans (strain DSM 10017 /
MPOB) GN=sfsA PE=3 SV=1
Length = 261

Score = 29.6 bits (65), Expect = 9.8
Identities = 14/37 (37%), Positives = 20/37 (54%)
Frame = +1

Query: 136 ADLPDTVLAELIHQLLKDFPKVWGHKLTATRLGHAMG 246
AD D V AEL H + ++W ++ TR G A+G
Sbjct: 217 ADFIDPVYAELFHAAVHAGVEIWPYEAVVTRQGIALG 253


>sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase
subunit beta-beta' OS=Helicobacter hepaticus GN=rpoBC
PE=3 SV=1
Length = 2894

Score = 29.6 bits (65), Expect = 9.8
Identities = 14/42 (33%), Positives = 23/42 (54%)
Frame = -1

Query: 314 IVASLDSKEKVRVVYFTAGKLVIPMAWPSLVAVSLWPQTFGK 189
I A + + RV+ TAG++++ P V ++LW QT K
Sbjct: 1933 INARIKTVHNRRVIDTTAGRMILSSILPDFVPLNLWNQTMKK 1974


tr_hit_id Q28XQ8
Definition tr|Q28XQ8|Q28XQ8_DROPS GA12325 OS=Drosophila pseudoobscura pseudoobscura
Align length 84
Score (bit) 34.3
E-value 4.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920633|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_E07.
(539 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q28XQ8|Q28XQ8_DROPS GA12325 OS=Drosophila pseudoobscura pseud... 34 4.3
tr|Q1JY46|Q1JY46_DESAC Two component, sigma54 specific, transcri... 33 7.3
tr|A2Q565|A2Q565_MEDTR Putative uncharacterized protein OS=Medic... 33 7.3

>tr|Q28XQ8|Q28XQ8_DROPS GA12325 OS=Drosophila pseudoobscura
pseudoobscura GN=GA12325 PE=4 SV=2
Length = 2988

Score = 34.3 bits (77), Expect = 4.3
Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
Frame = +3

Query: 93 DCSATDSGPHSIG*CRFT*YGSSRADTSTVERLS--KGLGPQANSYKAWPCHGYDQLSSC 266
DCS+ +SG + C GS +RLS + S +A PC YDQ C
Sbjct: 2702 DCSSDESGTN----CAACSGGSCNTFAFPSDRLSCHTCVDAACTSSRAQPCLAYDQEDYC 2757

Query: 267 EVYYSHFLFAVQGCDNSSMSRAIE 338
Y+ + GC +S S ++E
Sbjct: 2758 FAKYNEGAVELMGCASSQNSTSLE 2781


>tr|Q1JY46|Q1JY46_DESAC Two component, sigma54 specific,
transcriptional regulator, Fis family OS=Desulfuromonas
acetoxidans DSM 684 GN=Dace_0520 PE=4 SV=1
Length = 479

Score = 33.5 bits (75), Expect = 7.3
Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
Frame = +1

Query: 124 ALVDADLPDTVLAELIHQLLKDFPKVWGHKLTA-TRLGHAMGMTNFPAVKYTTRTFSLLS 300
AL+D +PD +L+ +L ++FP++ +TA + + +A+ A Y T+ F L +
Sbjct: 51 ALIDIKMPDVSGLDLLDELHENFPRLSVIMMTAESSMKNAVEAMKRGAYDYITKPFDLDA 110

Query: 301 KDATIQACQELLST 342
D I Q++ +T
Sbjct: 111 LDGIILKAQKIANT 124


>tr|A2Q565|A2Q565_MEDTR Putative uncharacterized protein OS=Medicago
truncatula GN=MtrDRAFT_AC160012g23v2 PE=4 SV=1
Length = 210

Score = 33.5 bits (75), Expect = 7.3
Identities = 17/42 (40%), Positives = 25/42 (59%)
Frame = +1

Query: 178 LLKDFPKVWGHKLTATRLGHAMGMTNFPAVKYTTRTFSLLSK 303
L +D KVW H++ +R + +GM+ FP Y +SLLSK
Sbjct: 167 LRRDLRKVWRHRMEVSRSANLVGMSVFPPDAY---PYSLLSK 205