BP920645
Clone id YMU001_000139_F09
Library
Length 499
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_F09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAAGAATTCGCGGCCTTTTTTTTTTTGCCTTAGCCTTCTCCTCGACAAGTTTATTGG
TTGTCTTGTGTGGAGACTCCAAAAACTCAAAAACTTTAAGAACACCTTCTTCCTTCTTTG
ATCCTTTCGACAAGTTCAGATCCAAAAGATCACCTATTTGATAAAGGATCTCTTTCACAA
CCTTCTCTAATCTCTCTTTGATTTTCAACTTCTCCTTCTCCTCGTTGCCACTCCAAACAA
ACCCTGAAAACTTCAATATATTTCCTTTTCCAGCATGCTTTGATGTCTTGCCAAATAGGA
CTTTGTGAAGTGCTTGAACTGCCTCATCACCGCTTCTACGTTTAGATAGTTTGAAGACAA
TATTGGGAATGTCTTTAAGAGCAGTACCAGTACCCTTGGGAATTCTAAACTCTTTGATCT
CCTTGTCTGGTGAAACAATCAGGCGTTCGACGGATTTACGTTCTCGAGTAGGCCTATCTG
ATGTTGGGGAGGGCAGTTC
■■Homology search results ■■ -
sp_hit_id Q43822
Definition sp|Q43822|PLSB_PHAVU Glycerol-3-phosphate acyltransferase, chloroplastic OS=Phaseolus vulgaris
Align length 41
Score (bit) 32.7
E-value 0.82
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920645|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_F09.
(470 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q43822|PLSB_PHAVU Glycerol-3-phosphate acyltransferase, chlor... 33 0.82
sp|O74343|YH2X_SCHPO Putative pseudouridine synthase C1A4.09 OS=... 31 3.1
sp|Q3UX43|AN13C_MOUSE Ankyrin repeat domain-containing protein 1... 31 3.1

>sp|Q43822|PLSB_PHAVU Glycerol-3-phosphate acyltransferase,
chloroplastic OS=Phaseolus vulgaris GN=PLSB PE=2 SV=1
Length = 461

Score = 32.7 bits (73), Expect = 0.82
Identities = 18/41 (43%), Positives = 22/41 (53%)
Frame = +2

Query: 83 PSLILSTSSDPKDHLFDKGSLSQPSLISL*FSTSPSPRCHS 205
P+ TS+ P+ L S S S ISL ST+PSP C S
Sbjct: 33 PTTFFPTSTTPRVTLLSSTSSSSSSSISLRSSTAPSPSCSS 73


>sp|O74343|YH2X_SCHPO Putative pseudouridine synthase C1A4.09
OS=Schizosaccharomyces pombe GN=SPBC1A4.09 PE=2 SV=1
Length = 680

Score = 30.8 bits (68), Expect = 3.1
Identities = 18/70 (25%), Positives = 34/70 (48%)
Frame = -1

Query: 467 LPSPTSDRPTRERKSVERLIVSPDKEIKEFRIPKGTGTALKDIPNIVFKLSKRRSGDEAV 288
L T D+ T + K +S D++ F+ + L +PN + + + G+E +
Sbjct: 100 LSKATGDKETEDAKDSSNQDISNDQKAPSFK--EQEPATLPILPNDLQSIIPKGIGNEFI 157

Query: 287 QALHKVLFGK 258
Q+LHK+ G+
Sbjct: 158 QSLHKLSVGE 167


>sp|Q3UX43|AN13C_MOUSE Ankyrin repeat domain-containing protein 13C
OS=Mus musculus GN=Ankrd13c PE=2 SV=2
Length = 541

Score = 30.8 bits (68), Expect = 3.1
Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
Frame = -2

Query: 463 PPQHQIGLLENVNPSNA*LFHQTRR---SKSLEFPRVLVLLLKTFPILSSNYLNVEAVMR 293
PPQ+ I E ++ N H R +S + + V + + FP+ + LNV V+
Sbjct: 415 PPQNTITWEEYISAENGKAPHLGRELVCKESKKTFKATVAMSQEFPLGIESLLNVLEVIA 474

Query: 292 QFKHFTK 272
FKHF K
Sbjct: 475 PFKHFNK 481


tr_hit_id Q9FM72
Definition tr|Q9FM72|Q9FM72_ARATH Genomic DNA, chromosome 5, P1 clone:MDF20 OS=Arabidopsis thaliana
Align length 154
Score (bit) 118.0
E-value 2.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920645|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_F09.
(470 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FM72|Q9FM72_ARATH Genomic DNA, chromosome 5, P1 clone:MDF20... 118 2e-25
tr|A9SW26|A9SW26_PHYPA Predicted protein OS=Physcomitrella paten... 118 2e-25
tr|A7Q977|A7Q977_VITVI Chromosome chr19 scaffold_66, whole genom... 117 2e-25
tr|Q9SUA1|Q9SUA1_ARATH Putative uncharacterized protein AT4g2663... 115 8e-25
tr|B6SWA1|B6SWA1_MAIZE Dek protein OS=Zea mays PE=2 SV=1 102 1e-20
tr|Q84JB7|Q84JB7_ARATH Putative uncharacterized protein At5g6355... 100 3e-20
tr|Q9FFQ8|Q9FFQ8_ARATH Emb|CAB62360.1 OS=Arabidopsis thaliana PE... 100 5e-20
tr|Q2PEY3|Q2PEY3_TRIPR Putative uncharacterized protein (Fragmen... 100 5e-20
tr|Q5JKH1|Q5JKH1_ORYSJ cDNA clone:J013128L13, full insert sequen... 99 1e-19
tr|B8A8G2|B8A8G2_ORYSI Putative uncharacterized protein OS=Oryza... 99 1e-19
tr|Q0WW14|Q0WW14_ARATH Putative uncharacterized protein At4g2663... 92 2e-17
tr|A7PHK6|A7PHK6_VITVI Chromosome chr17 scaffold_16, whole genom... 90 6e-17
tr|A5C8J3|A5C8J3_VITVI Putative uncharacterized protein OS=Vitis... 85 2e-15
tr|Q84TZ6|Q84TZ6_ORYSJ Putative uncharacterized protein OSJNBa00... 84 4e-15
tr|Q10H93|Q10H93_ORYSJ Os03g0596900 protein OS=Oryza sativa subs... 84 4e-15
tr|Q9SMM8|Q9SMM8_ARATH Putative uncharacterized protein T8P19.22... 83 8e-15
tr|Q8LFD2|Q8LFD2_ARATH Putative uncharacterized protein OS=Arabi... 83 8e-15
tr|Q0WMA0|Q0WMA0_ARATH Putative uncharacterized protein At3g4871... 83 8e-15
tr|A3AK49|A3AK49_ORYSJ Putative uncharacterized protein OS=Oryza... 79 1e-13
tr|A2XJ75|A2XJ75_ORYSI Putative uncharacterized protein OS=Oryza... 79 1e-13
tr|Q8RWF6|Q8RWF6_ARATH Putative uncharacterized protein At4g2663... 64 5e-09
tr|B8BYV7|B8BYV7_THAPS Predicted protein OS=Thalassiosira pseudo... 63 6e-09
tr|A4S131|A4S131_OSTLU Predicted protein OS=Ostreococcus lucimar... 63 6e-09
tr|A8JH97|A8JH97_CHLRE Predicted protein OS=Chlamydomonas reinha... 58 3e-07
tr|Q013V6|Q013V6_OSTTA Chromatin-associated protein Dek and rela... 56 8e-07
tr|Q68F75|Q68F75_XENTR Dek protein OS=Xenopus tropicalis GN=dek ... 49 2e-04
tr|Q2KHP5|Q2KHP5_XENLA Putative uncharacterized protein OS=Xenop... 48 2e-04
tr|Q8AVP7|Q8AVP7_XENLA LOC398543 protein (Fragment) OS=Xenopus l... 48 3e-04
tr|Q6DDW5|Q6DDW5_XENLA LOC398543 protein (Fragment) OS=Xenopus l... 48 3e-04
tr|A3A133|A3A133_ORYSJ Putative uncharacterized protein OS=Oryza... 44 0.005

>tr|Q9FM72|Q9FM72_ARATH Genomic DNA, chromosome 5, P1 clone:MDF20
OS=Arabidopsis thaliana PE=4 SV=1
Length = 759

Score = 118 bits (295), Expect = 2e-25
Identities = 69/154 (44%), Positives = 94/154 (61%), Gaps = 4/154 (2%)
Frame = -1

Query: 452 SDRPTRERKSVERLIVSPDKEI-KEFRIPKGTGTALKDIPNIVFKLSKRRSGDEAVQALH 276
SDRP RERKSVERL+ DK+ +EF + KG GT LKDIPN+ +K+S+++S DE + LH
Sbjct: 310 SDRPVRERKSVERLVAVVDKDSSREFHVEKGKGTPLKDIPNVAYKVSRKKS-DEVFKQLH 368

Query: 275 KVLFGKTSKHAG--KGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGDLLDLNL 102
+LFG A K +IL+FSG+ W G+ L + DL D+++
Sbjct: 369 TILFGGKRVKATQLKAHILRFSGYKWQGDEEKAKLKVKEKFEKINKEKLLEFCDLFDISV 428

Query: 101 SKG-SKKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
+K +KKE+ V K+ EFLE PH TT+ LV EK K
Sbjct: 429 AKATTKKEDIVTKLVEFLEKPHATTDVLVNEKEK 462


>tr|A9SW26|A9SW26_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_234215 PE=4 SV=1
Length = 726

Score = 118 bits (295), Expect = 2e-25
Identities = 76/173 (43%), Positives = 97/173 (56%), Gaps = 25/173 (14%)
Frame = -1

Query: 452 SDRPTRERKSVERLIVSPDK------EIKE-------------FRIPK-----GTGTALK 345
SDRPTRERK+++R I S +K EIK+ F + K G GT LK
Sbjct: 288 SDRPTRERKTIDRFIASAEKDNTKELEIKQCLTASPLYVISHCFAVHKACVYNGDGTPLK 347

Query: 344 DIPNIVFKLSKRRSGDEAVQALHKVLFGKTSKHAG-KGNILKFSGFVWSGNXXXXXXXXX 168
DIPN+V+KLSKR DE + LH +LF K K A K +IL+FSG+VWS N
Sbjct: 348 DIPNVVYKLSKRFKHDETLSQLHSILFNKRGKAAVLKRHILQFSGYVWSENKEKERAKIQ 407

Query: 167 XXXXXXXXXXLYQIGDLLDLNLSKGSKKEEGVLKVFEFLESPHKTTNKLVEEK 9
L Q D+LD+++SK KKE+ V KV EFLE PH+TT+ L+E K
Sbjct: 408 EKLERYTKDSLVQFVDVLDIHVSKTLKKEDLVAKVLEFLEKPHRTTDTLLEFK 460


>tr|A7Q977|A7Q977_VITVI Chromosome chr19 scaffold_66, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033365001
PE=4 SV=1
Length = 514

Score = 117 bits (294), Expect = 2e-25
Identities = 70/152 (46%), Positives = 94/152 (61%), Gaps = 3/152 (1%)
Frame = -1

Query: 455 TSDRPTRERKSVERLIVSPDKE-IKEFRIPKGTGTALKDIPNIVFKLSKRRSGDEAVQAL 279
T RP RERKSVERL+ S +++ KEF I KG GTALKDIPN+ +KLSKR+S D+ + L
Sbjct: 80 TIARPVRERKSVERLVASIERDSTKEFHIEKGRGTALKDIPNVAYKLSKRKS-DDTFKLL 138

Query: 278 HKVLFGKTSK-HAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGDLLDLNL 102
H +LFG+ K K NI +FSGFVW N L + D+LD+++
Sbjct: 139 HTILFGRRGKAFQVKNNISRFSGFVWHENEEKQKIKVKEKFDKCVKEKLLEFCDVLDISI 198

Query: 101 SK-GSKKEEGVLKVFEFLESPHKTTNKLVEEK 9
+K ++KE+ V K+ EFL +PH TT L+ EK
Sbjct: 199 AKTTTRKEDIVTKLIEFLVAPHPTTTVLLAEK 230


>tr|Q9SUA1|Q9SUA1_ARATH Putative uncharacterized protein AT4g26630
OS=Arabidopsis thaliana GN=AT4g26630 PE=4 SV=1
Length = 763

Score = 115 bits (289), Expect = 8e-25
Identities = 68/147 (46%), Positives = 91/147 (61%), Gaps = 4/147 (2%)
Frame = -1

Query: 461 SPTSDRPTRERKSVERLIVSPDKEI-KEFRIPKGTGTALKDIPNIVFKLSKRRSGDEAVQ 285
+P SDRP RERKSVERL+ DK+ KEFR+ KG G LKDIPN+ K+ ++RS DE ++
Sbjct: 313 TPFSDRPVRERKSVERLVALIDKDSSKEFRVEKGRGAYLKDIPNVANKVMRKRS-DETLK 371

Query: 284 ALHKVLFGKTSKHAG--KGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGDLLD 111
LH +LFG A K NIL FSGFVW G+ L++ D+LD
Sbjct: 372 LLHPILFGGRRGKAAQIKTNILGFSGFVWHGDEKKAKEKVKEKLEKCTKEKLWEFCDVLD 431

Query: 110 LNLSKG-SKKEEGVLKVFEFLESPHKT 33
++++K +KKE+ + K+FEFLE PH T
Sbjct: 432 IHITKATTKKEDIITKLFEFLEKPHVT 458


>tr|B6SWA1|B6SWA1_MAIZE Dek protein OS=Zea mays PE=2 SV=1
Length = 484

Score = 102 bits (253), Expect = 1e-20
Identities = 66/158 (41%), Positives = 93/158 (58%), Gaps = 6/158 (3%)
Frame = -1

Query: 458 PTSDRPTRERKSVERLI-----VSPDKEIKEFRIPKGTGTALKDIPNIVFKLSKRRSGDE 294
P +RP+RERK+VER +P K K I +G+GT LKDIPN+ FKLSKR++ DE
Sbjct: 49 PALERPSRERKTVERYSELAPRATPAK--KSPAILQGSGTKLKDIPNVSFKLSKRKA-DE 105

Query: 293 AVQALHKVLFG-KTSKHAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGDL 117
++Q+LH VL+G K++ H K NI +FSGFVW+ N L ++
Sbjct: 106 SLQSLHTVLYGRKSNNHFLKRNISQFSGFVWTDNQEKHRTKIKEKLEKFNKEKLLDFCEI 165

Query: 116 LDLNLSKGSKKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
LD+ + +KKEE K+ EFLESP T + ++ +K K
Sbjct: 166 LDVIVKVTTKKEEVSAKLLEFLESPCVTRDVILTDKKK 203


>tr|Q84JB7|Q84JB7_ARATH Putative uncharacterized protein At5g63550
OS=Arabidopsis thaliana GN=At5g63550 PE=2 SV=1
Length = 530

Score = 100 bits (250), Expect = 3e-20
Identities = 68/164 (41%), Positives = 93/164 (56%), Gaps = 8/164 (4%)
Frame = -1

Query: 470 ELPSPTSDRPTRERKSVERLIVSPDKEI---KEFRIPKGTGTALKDIPNIVFKLSKRRSG 300
E +PTS+RPTRERK VER +S K I KG GT L++IPN+ KLSKR++
Sbjct: 92 ETVTPTSERPTRERKKVERFSLSTPMRAPPSKSVSIEKGRGTPLREIPNVAHKLSKRKA- 150

Query: 299 DEAVQALHKVLFGKTSK-HAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQI- 126
D+ + LH +LFGK +K K NI +FSGF WS +
Sbjct: 151 DDNLMLLHTILFGKKAKAQMVKRNIGQFSGFAWSEKEEEKQRARIKEKIDKCVKEKLIVF 210

Query: 125 GDLLDLNLSKGS-KKEEGVLKVFEFLESPHKTTNKLV--EEKAK 3
D+LD+ +S+ + KKEE +KV EFLESP +T + ++ +EKAK
Sbjct: 211 CDVLDIPISRSNVKKEELAVKVLEFLESPKETRDVIIADQEKAK 254


>tr|Q9FFQ8|Q9FFQ8_ARATH Emb|CAB62360.1 OS=Arabidopsis thaliana PE=4
SV=1
Length = 531

Score = 100 bits (248), Expect = 5e-20
Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 6/162 (3%)
Frame = -1

Query: 470 ELPSPTSDRPTRERKSVERLIVSPDKEI---KEFRIPKGTGTALKDIPNIVFKLSKRRSG 300
E +PTS+RPTRERK VER +S K I KG GT L++IPN+ KLSKR++
Sbjct: 92 ETVTPTSERPTRERKKVERFSLSTPMRAPPSKSVSIEKGRGTPLREIPNVAHKLSKRKA- 150

Query: 299 DEAVQALHKVLFGKTSK-HAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQI- 126
D+ + LH +LFGK +K K NI +FSGF WS +
Sbjct: 151 DDNLMLLHTILFGKKAKAQMVKRNIGQFSGFAWSEKEEEKQRARIKEKIDKCVKEKLIVF 210

Query: 125 GDLLDLNLSKGS-KKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
D+LD+ +S+ + KKEE +KV EFLESP +T + ++ ++ K
Sbjct: 211 CDVLDIPISRSNVKKEELAVKVLEFLESPKETRDVIIADQEK 252


>tr|Q2PEY3|Q2PEY3_TRIPR Putative uncharacterized protein (Fragment)
OS=Trifolium pratense PE=2 SV=1
Length = 590

Score = 100 bits (248), Expect = 5e-20
Identities = 62/154 (40%), Positives = 89/154 (57%), Gaps = 3/154 (1%)
Frame = -1

Query: 455 TSDRPTRERKSVERLIVSPDKEI-KEFRIPKGTGTALKDIPNIVFKLSKRRSGDEAVQAL 279
T++RP RERKSV+RLI S + + KEF I KG GT LKDIPN+ FKLSK R+ D+ ++ L
Sbjct: 92 TTNRPVRERKSVKRLIESEETDASKEFHIEKGRGTPLKDIPNVAFKLSK-RTVDDNLKLL 150

Query: 278 HKVLFGKTSKHAG-KGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGDLLDLNL 102
H +LF + K K NI FSGFVW N L + D+LD+ +
Sbjct: 151 HTILFSRRGKATEIKNNISSFSGFVWHENEENQMIKLKEKFDKCNKENLMEFCDVLDMPV 210

Query: 101 SK-GSKKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
+ ++KE+ + K+ ++L +P T L+ E+ K
Sbjct: 211 TNANTRKEDIIAKLIDYLVAPKATKTVLLAEQEK 244


>tr|Q5JKH1|Q5JKH1_ORYSJ cDNA clone:J013128L13, full insert sequence
OS=Oryza sativa subsp. japonica GN=B1033B05.16 PE=2 SV=1
Length = 509

Score = 98.6 bits (244), Expect = 1e-19
Identities = 66/160 (41%), Positives = 97/160 (60%), Gaps = 7/160 (4%)
Frame = -1

Query: 461 SPTSDRPTRERKSVERLI-----VSPDKEIKEFRIPKGTGTALKDIPNIVFKLSKRRSGD 297
+PT +RP+RERK+VER V+P K K I +G+G+ LKDIPNI FKLSKR++ D
Sbjct: 60 TPTIERPSRERKTVERYSELAPRVTPAK--KSPAILQGSGSKLKDIPNIQFKLSKRKA-D 116

Query: 296 EAVQALHKVLFG-KTSKHAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGD 120
E +Q+LH +++G K++ H K NI +FSGFVW+ N L +
Sbjct: 117 ENLQSLHVLMYGRKSNVHFLKRNISQFSGFVWTDNQEKQRTRIKEKLDKFNKEKLLDFCE 176

Query: 119 LLDLNLSK-GSKKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
+LD+++S+ +KKEE K+ EFLESP T + ++ + K
Sbjct: 177 ILDIHVSRAATKKEEVSAKLLEFLESPCITRDVVLTDDKK 216


>tr|B8A8G2|B8A8G2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04995 PE=4 SV=1
Length = 509

Score = 98.6 bits (244), Expect = 1e-19
Identities = 66/160 (41%), Positives = 97/160 (60%), Gaps = 7/160 (4%)
Frame = -1

Query: 461 SPTSDRPTRERKSVERLI-----VSPDKEIKEFRIPKGTGTALKDIPNIVFKLSKRRSGD 297
+PT +RP+RERK+VER V+P K K I +G+G+ LKDIPNI FKLSKR++ D
Sbjct: 60 TPTIERPSRERKTVERYSELAPRVTPAK--KSPAILQGSGSKLKDIPNIQFKLSKRKA-D 116

Query: 296 EAVQALHKVLFG-KTSKHAGKGNILKFSGFVWSGNXXXXXXXXXXXXXXXXXXXLYQIGD 120
E +Q+LH +++G K++ H K NI +FSGFVW+ N L +
Sbjct: 117 ENLQSLHVLMYGRKSNVHFLKRNISQFSGFVWTDNQEKQRTRIKEKLDKFNKEKLLDFCE 176

Query: 119 LLDLNLSK-GSKKEEGVLKVFEFLESPHKTTNKLVEEKAK 3
+LD+++S+ +KKEE K+ EFLESP T + ++ + K
Sbjct: 177 ILDIHVSRAATKKEEVSAKLLEFLESPCITRDVVLTDDKK 216