BP920663
Clone id YMU001_000139_H10
Library
Length 351
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000139_H10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCCTCGATAAGCATCATAGTAACTGTCAAAAATCAAGGCTCTCAAAGGATTTGTAGAGG
TGTCTTTAGGTGCTGGAATTTTTGTCACGATGGACTCTAAAATTTCCCGTATACCAATGC
CTTCCTTAGCAGAGCAAAGAATGGCGTCAGAACAATCAAGCCCTACAATCTCTTCAATTT
CGCTACGAACTCGTTCTGCATCAGCCCCTGGAAGATCAATGTTATTGAGCACCGGTATTA
TTTCCAAATTATTTTCCAAAGCAAGGTAAACATTGGCAAGAGTCTGTGCTTCTACACCCT
GAGAAGCATCAACAACCAGAAGGGCACCCTCACACGCAGCCAGTGAGCGAG
■■Homology search results ■■ -
sp_hit_id Q8DM20
Definition sp|Q8DM20|LEPA_THEEB GTP-binding protein lepA OS=Thermosynechococcus elongatus (strain BP-1)
Align length 116
Score (bit) 191.0
E-value 1.0e-48
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920663|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_H10.
(351 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8DM20|LEPA_THEEB GTP-binding protein lepA OS=Thermosynechoco... 191 1e-48
sp|Q2JQ51|LEPA_SYNJB GTP-binding protein lepA OS=Synechococcus s... 188 8e-48
sp|Q2JWR1|LEPA_SYNJA GTP-binding protein lepA OS=Synechococcus s... 186 2e-47
sp|Q112D2|LEPA_TRIEI GTP-binding protein lepA OS=Trichodesmium e... 184 1e-46
sp|B0JQT7|LEPA_MICAN GTP-binding protein lepA OS=Microcystis aer... 184 1e-46
sp|B0C9R9|LEPA_ACAM1 GTP-binding protein lepA OS=Acaryochloris m... 184 1e-46
sp|Q31R08|LEPA_SYNE7 GTP-binding protein lepA OS=Synechococcus e... 183 3e-46
sp|Q31CB8|LEPA_PROM9 GTP-binding protein lepA OS=Prochlorococcus... 181 8e-46
sp|P74751|LEPA_SYNY3 GTP-binding protein lepA OS=Synechocystis s... 181 1e-45
sp|A5GRE6|LEPA_SYNR3 GTP-binding protein lepA OS=Synechococcus s... 181 1e-45
sp|Q5N390|LEPA_SYNP6 GTP-binding protein lepA OS=Synechococcus s... 180 2e-45
sp|Q3MG20|LEPA_ANAVT GTP-binding protein lepA OS=Anabaena variab... 180 2e-45
sp|Q8YU48|LEPA_ANASP GTP-binding protein lepA OS=Anabaena sp. (s... 180 2e-45
sp|A2BPP8|LEPA_PROMS GTP-binding protein lepA OS=Prochlorococcus... 179 3e-45
sp|A8G3D2|LEPA_PROM2 GTP-binding protein lepA OS=Prochlorococcus... 179 3e-45
sp|A3PBD8|LEPA_PROM0 GTP-binding protein lepA OS=Prochlorococcus... 179 3e-45
sp|Q7VDF7|LEPA_PROMA GTP-binding protein lepA OS=Prochlorococcus... 179 4e-45
sp|A5GMR2|LEPA_SYNPW GTP-binding protein lepA OS=Synechococcus s... 179 5e-45
sp|Q7NGX4|LEPA_GLOVI GTP-binding protein lepA OS=Gloeobacter vio... 179 5e-45
sp|Q3AWX3|LEPA_SYNS9 GTP-binding protein lepA OS=Synechococcus s... 178 8e-45
sp|Q0ICF2|LEPA_SYNS3 GTP-binding protein lepA OS=Synechococcus s... 178 8e-45
sp|A5G4G3|LEPA_GEOUR GTP-binding protein lepA OS=Geobacter urani... 176 2e-44
sp|A2CBG9|LEPA_PROM3 GTP-binding protein lepA OS=Prochlorococcus... 176 4e-44
sp|Q8DTF3|LEPA_STRMU GTP-binding protein lepA OS=Streptococcus m... 175 5e-44
sp|A2BV79|LEPA_PROM5 GTP-binding protein lepA OS=Prochlorococcus... 175 5e-44
sp|Q3ALG5|LEPA_SYNSC GTP-binding protein lepA OS=Synechococcus s... 175 7e-44
sp|Q7U5L9|LEPA_SYNPX GTP-binding protein lepA OS=Synechococcus s... 175 7e-44
sp|A4J7F8|LEPA_DESRM GTP-binding protein lepA OS=Desulfotomaculu... 175 7e-44
sp|Q24SR6|LEPA_DESHY GTP-binding protein lepA OS=Desulfitobacter... 175 7e-44
sp|Q8DPN5|LEPA_STRR6 GTP-binding protein lepA OS=Streptococcus p... 174 9e-44

>sp|Q8DM20|LEPA_THEEB GTP-binding protein lepA
OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA
PE=3 SV=1
Length = 603

Score = 191 bits (484), Expect = 1e-48
Identities = 96/116 (82%), Positives = 105/116 (90%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALE+NLEIIPVLN IDLPGA+ +RV++EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALEHNLEIIPVLNKIDLPGAEPDRVKAEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLDCS A+L SAKEGIGI EILESIV +P P+DT PLRALIFDSYYDAYRG
Sbjct: 155 IIGLDCSQAVLASAKEGIGIEEILESIVHLVPPPRDTVDQPLRALIFDSYYDAYRG 210


>sp|Q2JQ51|LEPA_SYNJB GTP-binding protein lepA OS=Synechococcus sp.
GN=lepA PE=3 SV=1
Length = 603

Score = 188 bits (477), Expect = 8e-48
Identities = 93/116 (80%), Positives = 105/116 (90%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPV+N IDLPGA+ ERV +EIE+
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVINKIDLPGAEPERVIAEIEQ 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
++GLDCS AIL SAK GIGI+EILE++V ++P P+DT PLRALIFDSYYDAYRG
Sbjct: 155 VIGLDCSGAILASAKVGIGIQEILEAVVQRVPPPRDTVAEPLRALIFDSYYDAYRG 210


>sp|Q2JWR1|LEPA_SYNJA GTP-binding protein lepA OS=Synechococcus sp.
(strain JA-3-3Ab) GN=lepA PE=3 SV=1
Length = 603

Score = 186 bits (473), Expect = 2e-47
Identities = 93/116 (80%), Positives = 105/116 (90%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPV+N IDLPGA+ ERV +EIE+
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVINKIDLPGAEPERVIAEIEQ 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
++GLDCS AIL SAK GIGI EILE+IV ++P P+DT +PLRALIFDSYYD+YRG
Sbjct: 155 VIGLDCSGAILASAKMGIGIPEILEAIVQRVPPPRDTVADPLRALIFDSYYDSYRG 210


>sp|Q112D2|LEPA_TRIEI GTP-binding protein lepA OS=Trichodesmium
erythraeum (strain IMS101) GN=lepA PE=3 SV=1
Length = 601

Score = 184 bits (467), Expect = 1e-46
Identities = 95/116 (81%), Positives = 103/116 (88%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALE++LEIIPVLN IDLPGA+ ERV+ EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALEHDLEIIPVLNKIDLPGAEPERVKEEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLDCS AIL SAKEGIGI EILESIV +P P+DT LRALIFDSYYD+YRG
Sbjct: 155 IIGLDCSGAILASAKEGIGIPEILESIVQLVPPPQDTIGEKLRALIFDSYYDSYRG 210


>sp|B0JQT7|LEPA_MICAN GTP-binding protein lepA OS=Microcystis
aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1
Length = 603

Score = 184 bits (467), Expect = 1e-46
Identities = 94/116 (81%), Positives = 101/116 (87%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLP A+ ERV +EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPSAEPERVAAEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
+VGLDCS+AI SAK GIGI +ILESIV +P P+DT P RALIFDSYYDAYRG
Sbjct: 155 VVGLDCSEAIRASAKAGIGINDILESIVQLVPPPQDTLEEPFRALIFDSYYDAYRG 210


>sp|B0C9R9|LEPA_ACAM1 GTP-binding protein lepA OS=Acaryochloris
marina (strain MBIC 11017) GN=lepA PE=3 SV=1
Length = 603

Score = 184 bits (467), Expect = 1e-46
Identities = 94/116 (81%), Positives = 103/116 (88%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLA+E++LEIIPVLN IDLPGA+ +RV+ EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLAIEHDLEIIPVLNKIDLPGAEPDRVKQEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
IVGLDCS AIL SAK GIGI EILESIV +P P+DT+ PLRALIFDSYYD YRG
Sbjct: 155 IVGLDCSGAILASAKTGIGIAEILESIVHLVPPPEDTTQEPLRALIFDSYYDLYRG 210


>sp|Q31R08|LEPA_SYNE7 GTP-binding protein lepA OS=Synechococcus
elongatus (strain PCC 7942) GN=lepA PE=3 SV=1
Length = 604

Score = 183 bits (464), Expect = 3e-46
Identities = 94/116 (81%), Positives = 100/116 (86%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSL ACEGALLVVDASQGVEAQTLANVYLALEN+LEIIPVLN IDLPGAD ERV+ EIEE
Sbjct: 95 RSLQACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGADPERVKREIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
++GLDCS AI SAK GIGI EILESIV +P P DT+ PLRALIFDSYYD YRG
Sbjct: 155 VIGLDCSGAIEASAKSGIGIGEILESIVHLVPPPSDTTGEPLRALIFDSYYDPYRG 210


>sp|Q31CB8|LEPA_PROM9 GTP-binding protein lepA OS=Prochlorococcus
marinus (strain MIT 9312) GN=lepA PE=3 SV=1
Length = 602

Score = 181 bits (460), Expect = 8e-46
Identities = 89/116 (76%), Positives = 103/116 (88%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSL ACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN +DLPGADAE+++ EIEE
Sbjct: 95 RSLQACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKVDLPGADAEKIKQEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLD S+AI CSAK G+GI++ILE+IV ++PAP+D P +ALIFDSYYD YRG
Sbjct: 155 IIGLDTSNAINCSAKTGVGIKDILEAIVRRVPAPQDEIKLPTKALIFDSYYDPYRG 210


>sp|P74751|LEPA_SYNY3 GTP-binding protein lepA OS=Synechocystis sp.
(strain PCC 6803) GN=lepA PE=3 SV=1
Length = 603

Score = 181 bits (459), Expect = 1e-45
Identities = 91/116 (78%), Positives = 101/116 (87%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLAL+NNLEIIPVLN IDLP A+ +RV +EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALDNNLEIIPVLNKIDLPSAEPDRVAAEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
+VGLDCSD I SAK GIG+ +ILE+IV ++P P DT PLRALIFDSYYDAYRG
Sbjct: 155 VVGLDCSDIIQASAKAGIGVDDILEAIVQQVPPPADTVDQPLRALIFDSYYDAYRG 210


>sp|A5GRE6|LEPA_SYNR3 GTP-binding protein lepA OS=Synechococcus sp.
(strain RCC307) GN=lepA PE=3 SV=1
Length = 604

Score = 181 bits (459), Expect = 1e-45
Identities = 90/116 (77%), Positives = 103/116 (88%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSL ACEGALLVVDASQGVEAQTLANVYLAL N+LEIIPVLN IDLPGADAER+ +EIEE
Sbjct: 95 RSLQACEGALLVVDASQGVEAQTLANVYLALGNDLEIIPVLNKIDLPGADAERISTEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLD S+AI CSAK G+G+ EIL++IV ++PAP DT+ PL+ALIFDSYYD YRG
Sbjct: 155 IIGLDTSNAIHCSAKTGLGVPEILQAIVDRVPAPPDTTEEPLKALIFDSYYDPYRG 210


tr_hit_id A9RFQ5
Definition tr|A9RFQ5|A9RFQ5_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 116
Score (bit) 199.0
E-value 7.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920663|Adiantum capillus-veneris mRNA, clone:
YMU001_000139_H10.
(351 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RFQ5|A9RFQ5_PHYPA Predicted protein OS=Physcomitrella paten... 199 7e-50
tr|A0YU54|A0YU54_9CYAN GTP-binding protein LepA OS=Lyngbya sp. P... 192 5e-48
tr|Q9FNM5|Q9FNM5_ARATH GTP-binding protein LepA homolog OS=Arabi... 191 2e-47
tr|Q6ET52|Q6ET52_ORYSJ Putative LepA protein OS=Oryza sativa sub... 191 2e-47
tr|Q0E3S2|Q0E3S2_ORYSJ Os02g0157700 protein OS=Oryza sativa subs... 191 2e-47
tr|B8AI54|B8AI54_ORYSI Putative uncharacterized protein OS=Oryza... 191 2e-47
tr|A3A3B7|A3A3B7_ORYSJ Putative uncharacterized protein OS=Oryza... 191 2e-47
tr|Q8RWP3|Q8RWP3_ARATH GTP-binding protein LepA homolog OS=Arabi... 190 3e-47
tr|A7PKM1|A7PKM1_VITVI Chromosome chr7 scaffold_20, whole genome... 189 6e-47
tr|A5B4D2|A5B4D2_VITVI Putative uncharacterized protein OS=Vitis... 189 6e-47
tr|B4AXP7|B4AXP7_9CHRO GTP-binding protein LepA OS=Cyanothece sp... 189 8e-47
tr|B8HLK8|B8HLK8_9CHRO GTP-binding protein LepA OS=Cyanothece sp... 188 1e-46
tr|B5VXW4|B5VXW4_SPIMA GTP-binding protein LepA OS=Arthrospira m... 188 1e-46
tr|B7KJX0|B7KJX0_9CHRO GTP-binding protein LepA OS=Cyanothece sp... 187 2e-46
tr|B4WIE0|B4WIE0_9SYNE GTP-binding protein LepA OS=Synechococcus... 185 1e-45
tr|Q4BVI3|Q4BVI3_CROWT Small GTP-binding protein domain:GTP-bind... 184 1e-45
tr|B4W0T1|B4W0T1_9CYAN GTP-binding protein LepA OS=Microcoleus c... 184 1e-45
tr|A8YK29|A8YK29_MICAE LepA protein OS=Microcystis aeruginosa PC... 184 2e-45
tr|B1XK44|B1XK44_SYNP2 GTP-binding protein LepA OS=Synechococcus... 182 5e-45
tr|B2J0M4|B2J0M4_NOSP7 GTP-binding protein LepA OS=Nostoc puncti... 182 9e-45
tr|B7K3Z7|B7K3Z7_SYNP8 GTP-binding protein LepA OS=Synechococcus... 182 9e-45
tr|B4BYB5|B4BYB5_9CHRO GTP-binding protein LepA OS=Cyanothece sp... 182 9e-45
tr|A0ZHV4|A0ZHV4_NODSP GTP-binding protein LepA OS=Nodularia spu... 182 9e-45
tr|Q1PJY9|Q1PJY9_PROMA GTP-binding protein LepA OS=uncultured Pr... 179 5e-44
tr|B1WWD8|B1WWD8_CYAA5 GTP-binding protein OS=Cyanothece (strain... 178 1e-43
tr|A3IVA8|A3IVA8_9CHRO GTP-binding protein LepA OS=Cyanothece sp... 178 1e-43
tr|B5IP12|B5IP12_9CHRO GTP-binding protein LepA OS=Cyanobium sp.... 178 1e-43
tr|B1X3K4|B1X3K4_PAUCH GTP-binding protein LepA OS=Paulinella ch... 178 1e-43
tr|Q0QKW0|Q0QKW0_9SYNE GTP binding protein LepA OS=uncultured ma... 177 2e-43
tr|Q060J9|Q060J9_9SYNE GTP-binding protein LepA OS=Synechococcus... 177 2e-43

>tr|A9RFQ5|A9RFQ5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_158777 PE=4 SV=1
Length = 735

Score = 199 bits (505), Expect = 7e-50
Identities = 99/116 (85%), Positives = 107/116 (92%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALE+NLEIIPVLN IDLPGAD ERVR EIEE
Sbjct: 225 RSLAACEGALLVVDASQGVEAQTLANVYLALESNLEIIPVLNKIDLPGADPERVRREIEE 284

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLDCS+AILCSAKEG+GI EIL ++V KIP PKDT+ PLRALIFDSYYD+YRG
Sbjct: 285 IIGLDCSEAILCSAKEGVGIPEILNAVVKKIPPPKDTAAEPLRALIFDSYYDSYRG 340


>tr|A0YU54|A0YU54_9CYAN GTP-binding protein LepA OS=Lyngbya sp. PCC
8106 GN=L8106_30200 PE=4 SV=1
Length = 604

Score = 192 bits (489), Expect = 5e-48
Identities = 98/116 (84%), Positives = 105/116 (90%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLPGA+ ERV+ EIEE
Sbjct: 95 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPERVKEEIEE 154

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+GLDCSDAIL SAKEGIGI EILESIV +P P+DT + LRALIFDSYYD+YRG
Sbjct: 155 IIGLDCSDAILASAKEGIGINEILESIVKLVPPPEDTVSQKLRALIFDSYYDSYRG 210


>tr|Q9FNM5|Q9FNM5_ARATH GTP-binding protein LepA homolog
OS=Arabidopsis thaliana PE=4 SV=1
Length = 675

Score = 191 bits (484), Expect = 2e-47
Identities = 96/116 (82%), Positives = 104/116 (89%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLPGA+ E+V EIEE
Sbjct: 165 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPEKVLREIEE 224

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
++GLDCS AI CSAKEGIGI EIL++IV +IPAP DT+ PLRALIFDSYYD YRG
Sbjct: 225 VIGLDCSKAIFCSAKEGIGITEILDAIVQRIPAPLDTAGKPLRALIFDSYYDPYRG 280


>tr|Q6ET52|Q6ET52_ORYSJ Putative LepA protein OS=Oryza sativa subsp.
japonica GN=P0419H03.27 PE=4 SV=1
Length = 680

Score = 191 bits (484), Expect = 2e-47
Identities = 95/116 (81%), Positives = 107/116 (92%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALEN+LEIIPVLN IDLPGA+ +RV EIEE
Sbjct: 162 RSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGAEPDRVAQEIEE 221

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+G+DCS+AI CSAKEGIGI EIL++IVTKIP P++T+ +PLRALIFDSYYD YRG
Sbjct: 222 IIGMDCSNAIRCSAKEGIGITEILDAIVTKIPPPQNTAISPLRALIFDSYYDPYRG 277


>tr|Q0E3S2|Q0E3S2_ORYSJ Os02g0157700 protein OS=Oryza sativa subsp.
japonica GN=Os02g0157700 PE=4 SV=1
Length = 628

Score = 191 bits (484), Expect = 2e-47
Identities = 95/116 (81%), Positives = 107/116 (92%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALEN+LEIIPVLN IDLPGA+ +RV EIEE
Sbjct: 162 RSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGAEPDRVAQEIEE 221

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+G+DCS+AI CSAKEGIGI EIL++IVTKIP P++T+ +PLRALIFDSYYD YRG
Sbjct: 222 IIGMDCSNAIRCSAKEGIGITEILDAIVTKIPPPQNTAISPLRALIFDSYYDPYRG 277


>tr|B8AI54|B8AI54_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05919 PE=4 SV=1
Length = 636

Score = 191 bits (484), Expect = 2e-47
Identities = 95/116 (81%), Positives = 107/116 (92%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALEN+LEIIPVLN IDLPGA+ +RV EIEE
Sbjct: 118 RSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGAEPDRVAQEIEE 177

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+G+DCS+AI CSAKEGIGI EIL++IVTKIP P++T+ +PLRALIFDSYYD YRG
Sbjct: 178 IIGMDCSNAIRCSAKEGIGITEILDAIVTKIPPPQNTAISPLRALIFDSYYDPYRG 233


>tr|A3A3B7|A3A3B7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005289 PE=4 SV=1
Length = 624

Score = 191 bits (484), Expect = 2e-47
Identities = 95/116 (81%), Positives = 107/116 (92%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALEN+LEIIPVLN IDLPGA+ +RV EIEE
Sbjct: 162 RSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGAEPDRVAQEIEE 221

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
I+G+DCS+AI CSAKEGIGI EIL++IVTKIP P++T+ +PLRALIFDSYYD YRG
Sbjct: 222 IIGMDCSNAIRCSAKEGIGITEILDAIVTKIPPPQNTAISPLRALIFDSYYDPYRG 277


>tr|Q8RWP3|Q8RWP3_ARATH GTP-binding protein LepA homolog
OS=Arabidopsis thaliana GN=At5g08650 PE=2 SV=1
Length = 681

Score = 190 bits (482), Expect = 3e-47
Identities = 95/116 (81%), Positives = 104/116 (89%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLPGA+ E+V EIEE
Sbjct: 171 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPEKVLREIEE 230

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
++GLDCS AI CSAKEGIGI EIL++IV +IPAP DT+ PLRA+IFDSYYD YRG
Sbjct: 231 VIGLDCSKAIFCSAKEGIGITEILDAIVQRIPAPLDTAGKPLRAIIFDSYYDPYRG 286


>tr|A7PKM1|A7PKM1_VITVI Chromosome chr7 scaffold_20, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019235001
PE=4 SV=1
Length = 603

Score = 189 bits (480), Expect = 6e-47
Identities = 97/116 (83%), Positives = 102/116 (87%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLPGA+ RV EIEE
Sbjct: 93 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPVRVSQEIEE 152

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
+VGLDCSDAI CSAKEGIGI EIL +IV +IP P DT+ PLRALIFDSYYD YRG
Sbjct: 153 VVGLDCSDAIHCSAKEGIGITEILNAIVKRIPPPCDTAERPLRALIFDSYYDPYRG 208


>tr|A5B4D2|A5B4D2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013255 PE=4 SV=1
Length = 680

Score = 189 bits (480), Expect = 6e-47
Identities = 97/116 (83%), Positives = 102/116 (87%)
Frame = -3

Query: 349 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNNIDLPGADAERVRSEIEE 170
RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLN IDLPGA+ RV EIEE
Sbjct: 170 RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPVRVSQEIEE 229

Query: 169 IVGLDCSDAILCSAKEGIGIREILESIVTKIPAPKDTSTNPLRALIFDSYYDAYRG 2
+VGLDCSDAI CSAKEGIGI EIL +IV +IP P DT+ PLRALIFDSYYD YRG
Sbjct: 230 VVGLDCSDAIHCSAKEGIGITEILNAIVKRIPPPCDTAERPLRALIFDSYYDPYRG 285