BP920690
Clone id YMU001_000140_C04
Library
Length 609
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000140_C04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGAATACACTGAAAGATGGCAGAATGTTCCGAGTCTGCAGGAAGAATCTTGATATTGTGT
TTCTTTGCTAAAGGAAGTACATAAGGGCCTCCGGCAATCAGTGTCTCTTTGTTCGCTAAA
GCTATGTCTTTACCTGCTTCAATTGCAGCAACGGTTGGCTTCAAGCCAGCACAACCGACT
ATGCCAGTGACAACAGAGACAGCTTCAGGGTGTCTAGCAACCTCAACTATCCCTTCGTCC
CCAGCAACAATCTCAGGCTTATGATCAAGATCAGCTATGGCTTCTCTGATCTCAGGCACC
AGAGACACGTTCTTGATGGCAACAAGACTTGGCTTAAATCTCCGAACCTGATCAGCAAGC
AATGTGACGTTGGAGCCTGCTGCTAATGCAACAATTCTGAACTTGTCAGGGTGTTCAGCA
ACTATGTCAAGAGTCTGCGTTCCAATGGACCCAGTTGATCCTATTAAAGAGAGGGGCTTG
GGGCCTTCCCAAGTCTTTTTAACATCGCTGACCACAGCCCTTCCAGGCCAAGCAGGAGGT
GGCGAGGGCACAGCAGAACACTTCACACCTCTTACCAAGGTTTTGGCTCTCTCTCCTTTC
TGTTTAACT
■■Homology search results ■■ -
sp_hit_id Q9XFS9
Definition sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Arabidopsis thaliana
Align length 194
Score (bit) 312.0
E-value 7.0e-85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920690|Adiantum capillus-veneris mRNA, clone:
YMU001_000140_C04.
(609 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate reductoisomer... 312 7e-85
sp|Q8W250|DXR_ORYSJ 1-deoxy-D-xylulose 5-phosphate reductoisomer... 311 2e-84
sp|Q9XES0|DXR_MENPI 1-deoxy-D-xylulose 5-phosphate reductoisomer... 302 8e-82
sp|Q3MDL2|DXR_ANAVT 1-deoxy-D-xylulose 5-phosphate reductoisomer... 223 8e-58
sp|Q8YP49|DXR_ANASP 1-deoxy-D-xylulose 5-phosphate reductoisomer... 223 8e-58
sp|Q9RCT1|DXR_SYNP6 1-deoxy-D-xylulose 5-phosphate reductoisomer... 214 2e-55
sp|Q31N26|DXR_SYNE7 1-deoxy-D-xylulose 5-phosphate reductoisomer... 214 2e-55
sp|Q8DK30|DXR_THEEB 1-deoxy-D-xylulose 5-phosphate reductoisomer... 213 5e-55
sp|Q55663|DXR_SYNY3 1-deoxy-D-xylulose 5-phosphate reductoisomer... 211 3e-54
sp|Q2JXQ9|DXR_SYNJA 1-deoxy-D-xylulose 5-phosphate reductoisomer... 209 9e-54
sp|Q2JM39|DXR_SYNJB 1-deoxy-D-xylulose 5-phosphate reductoisomer... 207 4e-53
sp|Q319Z8|DXR_PROM9 1-deoxy-D-xylulose 5-phosphate reductoisomer... 189 1e-47
sp|Q7NID1|DXR_GLOVI 1-deoxy-D-xylulose 5-phosphate reductoisomer... 182 1e-45
sp|Q7U8C3|DXR_SYNPX 1-deoxy-D-xylulose 5-phosphate reductoisomer... 177 4e-44
sp|Q7V6J8|DXR_PROMM 1-deoxy-D-xylulose 5-phosphate reductoisomer... 177 5e-44
sp|A2C3T8|DXR_PROM1 1-deoxy-D-xylulose 5-phosphate reductoisomer... 177 5e-44
sp|Q7V0W0|DXR_PROMP 1-deoxy-D-xylulose 5-phosphate reductoisomer... 172 2e-42
sp|Q46JT6|DXR_PROMT 1-deoxy-D-xylulose 5-phosphate reductoisomer... 171 3e-42
sp|Q7VB62|DXR_PROMA 1-deoxy-D-xylulose 5-phosphate reductoisomer... 170 5e-42
sp|A2BXK2|DXR_PROM5 1-deoxy-D-xylulose 5-phosphate reductoisomer... 168 2e-41
sp|Q8KG43|DXR_CHLTE 1-deoxy-D-xylulose 5-phosphate reductoisomer... 167 3e-41
sp|Q67PA9|DXR_SYMTH 1-deoxy-D-xylulose 5-phosphate reductoisomer... 166 7e-41
sp|A5G7W2|DXR_GEOUR 1-deoxy-D-xylulose 5-phosphate reductoisomer... 162 1e-39
sp|Q3B6R4|DXR_PELLD 1-deoxy-D-xylulose 5-phosphate reductoisomer... 161 2e-39
sp|A1AQN8|DXR_PELPD 1-deoxy-D-xylulose 5-phosphate reductoisomer... 160 6e-39
sp|Q39W82|DXR_GEOMG 1-deoxy-D-xylulose 5-phosphate reductoisomer... 158 2e-38
sp|Q9KA69|DXR_BACHD 1-deoxy-D-xylulose 5-phosphate reductoisomer... 157 5e-38
sp|Q74BW4|DXR_GEOSL 1-deoxy-D-xylulose 5-phosphate reductoisomer... 155 2e-37
sp|Q6HEZ4|DXR2_BACHK 1-deoxy-D-xylulose 5-phosphate reductoisome... 155 2e-37
sp|Q819Y3|DXR2_BACCR 1-deoxy-D-xylulose 5-phosphate reductoisome... 155 2e-37

>sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate
reductoisomerase, chloroplastic OS=Arabidopsis thaliana
GN=DXR PE=2 SV=2
Length = 477

Score = 312 bits (800), Expect = 7e-85
Identities = 151/194 (77%), Positives = 177/194 (91%), Gaps = 4/194 (2%)
Frame = -2

Query: 572 RGVKCSAV----PSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIVAEHPD 405
+GVKCS PPPAWPGRAV +++W+GPKP+S++GSTGSIGTQTLDIVAE+PD
Sbjct: 46 KGVKCSVKVQQQQQPPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPD 105

Query: 404 KFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAGDEGIV 225
KFR+VALAAGSNVTLLADQVRRFKP+LVA++N SL+ E++EA+ADLD+K EI+ G++G++
Sbjct: 106 KFRVVALAAGSNVTLLADQVRRFKPALVAVRNESLINELKEALADLDYKLEIIPGEQGVI 165

Query: 224 EVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHNIKI 45
EVARHPEAV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KHN+KI
Sbjct: 166 EVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKI 225

Query: 44 LPADSEHSAIFQCI 3
LPADSEHSAIFQCI
Sbjct: 226 LPADSEHSAIFQCI 239


>sp|Q8W250|DXR_ORYSJ 1-deoxy-D-xylulose 5-phosphate
reductoisomerase, chloroplastic OS=Oryza sativa subsp.
japonica GN=DXR PE=2 SV=2
Length = 473

Score = 311 bits (796), Expect = 2e-84
Identities = 149/200 (74%), Positives = 177/200 (88%)
Frame = -2

Query: 602 QKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDI 423
Q +R +R CS +PPPAWPGRAVV +++W+GPKP+S++GSTGSIGTQTLDI
Sbjct: 36 QTRDRRAVSLRRTCCSMQQAPPPAWPGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDI 95

Query: 422 VAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVA 243
VAE+PDKFR+VALAAGSNVTLLADQV+ FKP LVA++N SLV E++EA+AD D KPEI+
Sbjct: 96 VAENPDKFRVVALAAGSNVTLLADQVKTFKPKLVAVRNESLVDELKEALADCDWKPEIIP 155

Query: 242 GDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAK 63
G++G++EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA+
Sbjct: 156 GEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQ 215

Query: 62 KHNIKILPADSEHSAIFQCI 3
KH +KILPADSEHSAIFQCI
Sbjct: 216 KHKVKILPADSEHSAIFQCI 235


>sp|Q9XES0|DXR_MENPI 1-deoxy-D-xylulose 5-phosphate
reductoisomerase, chloroplastic OS=Mentha piperita
GN=DXR PE=2 SV=2
Length = 470

Score = 302 bits (774), Expect = 8e-82
Identities = 149/194 (76%), Positives = 172/194 (88%), Gaps = 1/194 (0%)
Frame = -2

Query: 581 TLVRGVKCSAVP-SPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIVAEHPD 405
T + V CSA SPPPAWPGRA + TWEGPKP+S+IGSTGSIGTQTLDIVAE+PD
Sbjct: 40 TAAKRVHCSAQSQSPPPAWPGRAFPEPGRMTWEGPKPISVIGSTGSIGTQTLDIVAENPD 99

Query: 404 KFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAGDEGIV 225
KFRIVALAAGSNVTLLADQV+ FKP LV++K+ SL+ E++EA+A + PEI+ G++G++
Sbjct: 100 KFRIVALAAGSNVTLLADQVKAFKPKLVSVKDESLISELKEALAGFEDMPEIIPGEQGMI 159

Query: 224 EVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHNIKI 45
EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLAKKHN+KI
Sbjct: 160 EVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNVKI 219

Query: 44 LPADSEHSAIFQCI 3
LPADSEHSAIFQCI
Sbjct: 220 LPADSEHSAIFQCI 233


>sp|Q3MDL2|DXR_ANAVT 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937)
GN=dxr PE=3 SV=1
Length = 398

Score = 223 bits (567), Expect = 8e-58
Identities = 106/159 (66%), Positives = 136/159 (85%)
Frame = -2

Query: 479 KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSL 300
K ++L+GSTGSIGTQTLDIV+++PD+FRIV LAAGSNV +LA+Q+R+F+P + AI
Sbjct: 2 KSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEK 61

Query: 299 VPEIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIA 120
+P ++ AI DLD +P ++ G+ G++EVAR+ +A +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct: 62 LPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA 121

Query: 119 LANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
LANKETLIAGGP VLPL +KH +K+LPADSEHSAIFQC+
Sbjct: 122 LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCL 160


>sp|Q8YP49|DXR_ANASP 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Anabaena sp. (strain PCC 7120) GN=dxr PE=3 SV=1
Length = 399

Score = 223 bits (567), Expect = 8e-58
Identities = 106/159 (66%), Positives = 136/159 (85%)
Frame = -2

Query: 479 KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSL 300
K ++L+GSTGSIGTQTLDIV+++PD+FRIV LAAGSNV +LA+Q+R+F+P + AI
Sbjct: 3 KSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAEK 62

Query: 299 VPEIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIA 120
+P ++ AI DLD +P ++ G+ G++EVAR+ +A +VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct: 63 LPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDIA 122

Query: 119 LANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
LANKETLIAGGP VLPL +KH +K+LPADSEHSAIFQC+
Sbjct: 123 LANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCL 161


>sp|Q9RCT1|DXR_SYNP6 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 /
SAUG 1402/1) GN=dxr PE=1 SV=1
Length = 402

Score = 214 bits (546), Expect = 2e-55
Identities = 105/159 (66%), Positives = 133/159 (83%)
Frame = -2

Query: 479 KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSL 300
K ++L+GSTGSIGTQTLDI+ ++PD+FR+V LAAG NV LL++Q+RR +P +VAI++ +
Sbjct: 2 KAVTLLGSTGSIGTQTLDILEQYPDRFRLVGLAAGRNVALLSEQIRRHRPEIVAIQDAAQ 61

Query: 299 VPEIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIA 120
+ E++ AIADLD+ P I+ G+ G+ EVAR+ +A VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct: 62 LSELQAAIADLDNPPLILTGEAGVTEVARYGDAEIVVTGIVGCAGLLPTIAAIEAGKDIA 121

Query: 119 LANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
LANKETLIA GP VLPL +KH + I PADSEHSAIFQCI
Sbjct: 122 LANKETLIAAGPVVLPLLQKHGVTITPADSEHSAIFQCI 160


>sp|Q31N26|DXR_SYNE7 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Synechococcus elongatus (strain PCC 7942) GN=dxr PE=3
SV=1
Length = 402

Score = 214 bits (546), Expect = 2e-55
Identities = 105/159 (66%), Positives = 133/159 (83%)
Frame = -2

Query: 479 KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSL 300
K ++L+GSTGSIGTQTLDI+ ++PD+FR+V LAAG NV LL++Q+RR +P +VAI++ +
Sbjct: 2 KAVTLLGSTGSIGTQTLDILEQYPDRFRLVGLAAGRNVALLSEQIRRHRPEIVAIQDAAQ 61

Query: 299 VPEIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIA 120
+ E++ AIADLD+ P I+ G+ G+ EVAR+ +A VVTGIVGCAGL PT+AAIEAGKDIA
Sbjct: 62 LSELQAAIADLDNPPLILTGEAGVTEVARYGDAEIVVTGIVGCAGLLPTIAAIEAGKDIA 121

Query: 119 LANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
LANKETLIA GP VLPL +KH + I PADSEHSAIFQCI
Sbjct: 122 LANKETLIAAGPVVLPLLQKHGVTITPADSEHSAIFQCI 160


>sp|Q8DK30|DXR_THEEB 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Thermosynechococcus elongatus (strain BP-1) GN=dxr
PE=3 SV=1
Length = 413

Score = 213 bits (543), Expect = 5e-55
Identities = 106/172 (61%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
Frame = -2

Query: 506 DVKKTWEGP----KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRR 339
D+K + + P K L+L+GSTGSIGTQTLDIVA++PD+FR+V LAAG N+ L Q+R+
Sbjct: 7 DIKVSTDAPPKIVKALNLLGSTGSIGTQTLDIVAQYPDRFRVVGLAAGRNLERLIPQIRQ 66

Query: 338 FKPSLVAIKNVSLVPEIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLK 159
F+P +V+I + +PE+ A+ADL KP++VAG+ GI VA + +A VVTGIVGCAGL
Sbjct: 67 FQPEIVSIADPEQLPELEAALADLPQKPQLVAGEAGIAAVAAYGDAEVVVTGIVGCAGLV 126

Query: 158 PTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
PT+AAI+AGKDIALANKETLIAGGP VLPL +++ +K+LPADSEHSAIFQC+
Sbjct: 127 PTIAAIKAGKDIALANKETLIAGGPVVLPLLQEYGVKLLPADSEHSAIFQCL 178


>sp|Q55663|DXR_SYNY3 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Synechocystis sp. (strain PCC 6803) GN=dxr PE=3 SV=1
Length = 394

Score = 211 bits (536), Expect = 3e-54
Identities = 105/160 (65%), Positives = 130/160 (81%), Gaps = 1/160 (0%)
Frame = -2

Query: 479 KPLSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSL 300
K +S++GSTGSIGTQTLDIV HPD F++V LAAG NV LLA QV F+P +VAI+
Sbjct: 3 KRISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQAEK 62

Query: 299 VPEIREAIADL-DHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDI 123
+ +++ A+A+L D++P V G+EG+VEVAR+ +A SVVTGIVGCAGL PT+AAI AGKDI
Sbjct: 63 LEDLKAAVAELTDYQPMYVVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGKDI 122

Query: 122 ALANKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
ALANKETLIAG P VLPL +K +K+LPADSEHSAIFQC+
Sbjct: 123 ALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQCL 162


>sp|Q2JXQ9|DXR_SYNJA 1-deoxy-D-xylulose 5-phosphate reductoisomerase
OS=Synechococcus sp. (strain JA-3-3Ab) GN=dxr PE=3 SV=1
Length = 392

Score = 209 bits (532), Expect = 9e-54
Identities = 100/157 (63%), Positives = 129/157 (82%)
Frame = -2

Query: 473 LSLIGSTGSIGTQTLDIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVP 294
++L+GSTGSIGTQTLD+VA++P++FR+V L + SNVTLLA+QV RF+P +VAI L+P
Sbjct: 4 ITLLGSTGSIGTQTLDLVAQYPERFRVVGLTSYSNVTLLAEQVWRFRPQIVAIGREELLP 63

Query: 293 EIREAIADLDHKPEIVAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALA 114
E+R + + PE+VAG EG+ +VA HP A VVTGIVGCAGL PT+AAI AGKDIALA
Sbjct: 64 ELRSLLTGMRPLPELVAGTEGLCQVAAHPAAQRVVTGIVGCAGLLPTLAAIRAGKDIALA 123

Query: 113 NKETLIAGGPYVLPLAKKHNIKILPADSEHSAIFQCI 3
NKETL+AGGP VLPL +++ +K++P DSEHSAIFQC+
Sbjct: 124 NKETLVAGGPVVLPLVREYGVKLIPVDSEHSAIFQCL 160


tr_hit_id Q2L8A8
Definition tr|Q2L8A8|Q2L8A8_9LAMI 1-deoxy-D-xylulose-5-phosphate reductoisomerase OS=Picrorhiza kurrooa
Align length 200
Score (bit) 317.0
E-value 3.0e-85
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920690|Adiantum capillus-veneris mRNA, clone:
YMU001_000140_C04.
(609 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2L8A8|Q2L8A8_9LAMI 1-deoxy-D-xylulose-5-phosphate reductoiso... 317 3e-85
tr|B7UCR9|B7UCR9_SALMI 1-deoxy-d-xylulose 5-phosphate reductoiso... 317 4e-85
tr|A7PD04|A7PD04_VITVI Chromosome chr17 scaffold_12, whole genom... 316 6e-85
tr|Q6GZ43|Q6GZ43_TAXCU 1-deoxy-D-xylulose-5-phosphate reductoiso... 315 1e-84
tr|Q2VWR8|Q2VWR8_9CONI 1-deoxy-D-xylulose-5-phosphate reductoiso... 315 1e-84
tr|A0A1F2|A0A1F2_SALMI 1-deoxy-d-xylulose 5-phosphate reductoiso... 312 8e-84
tr|Q8L6C5|Q8L6C5_STERE 1-deoxy-D-xylulose 5-phosphate reductoiso... 311 1e-83
tr|Q5J7B3|Q5J7B3_GINBI Putative 1-deoxy-D-xylulose 5-phosphate r... 311 2e-83
tr|Q0JRD4|Q0JRD4_ORYSJ cDNA clone:J013075G02, full insert sequen... 311 2e-83
tr|A2WJR2|A2WJR2_ORYSI Putative uncharacterized protein OS=Oryza... 311 2e-83
tr|Q9FXZ7|Q9FXZ7_MAIZE 1-deoxy-D-xylulose 5-phosphate reductoiso... 310 3e-83
tr|Q0GYS3|Q0GYS3_HEVBR 1-deoxy-D-xylulose 5-phosphate reductoiso... 307 3e-82
tr|Q6R3F4|Q6R3F4_9LAMI 1-deoxy-D-xylulose-5-phosphate reductoiso... 307 4e-82
tr|A4L795|A4L795_9ROSI 1-deoxy-D-xylulose 5-phosphate reductoiso... 306 6e-82
tr|A1XG19|A1XG19_CAMAC 1-deoxy-D-xylulose 5-phosphate reductoiso... 305 1e-81
tr|A1KXW2|A1KXW2_HEVBR Putative 1-deoxy-D-xylulose 5-phosphate r... 305 1e-81
tr|Q14RS6|Q14RS6_NICBE 1-deoxy-D-xylulose-5-phosphate reductoiso... 305 1e-81
tr|Q9SP64|Q9SP64_ARTAN 1-deoxy-D-xylulose-5-phosphate reductoiso... 305 2e-81
tr|Q0MW94|Q0MW94_TOBAC 1-deoxy-D-xylulose-5-phosphate reductoiso... 305 2e-81
tr|Q2HXK1|Q2HXK1_CHRMO 1-deoxyxylulose 5-phosphate reductoisomer... 304 2e-81
tr|A9ZN08|A9ZN08_HEVBR 1-deoxy-D-xylulose-5-phosphate reductoiso... 304 2e-81
tr|Q947C3|Q947C3_SOLLC 1-deoxy-D-xylulose-5-phosphate reductoiso... 304 3e-81
tr|Q1L7P3|Q1L7P3_9GENT 1-deoxy-D-xylulose 5-phosphate reductoiso... 303 7e-81
tr|Q70EZ8|Q70EZ8_HORVU Putative 1-deoxy-D-xylulose 5-phosphate r... 302 9e-81
tr|B8A289|B8A289_MAIZE Putative uncharacterized protein OS=Zea m... 302 1e-80
tr|A2ZND1|A2ZND1_ORYSJ Putative uncharacterized protein OS=Oryza... 302 1e-80
tr|B3GEM1|B3GEM1_POPTR Putative chloroplast 1-deoxy-D-xylulose 5... 301 1e-80
tr|Q70KX8|Q70KX8_9ROSI 1-deoxy-D-xylulose-5-phosphate reductoiso... 298 1e-79
tr|Q5MJZ5|Q5MJZ5_ANTMA 1-deoxy-D-xylulose-5-phosphate reductoiso... 298 1e-79
tr|B7FJ27|B7FJ27_MEDTR Putative uncharacterized protein (Fragmen... 298 2e-79

>tr|Q2L8A8|Q2L8A8_9LAMI 1-deoxy-D-xylulose-5-phosphate
reductoisomerase OS=Picrorhiza kurrooa PE=2 SV=1
Length = 475

Score = 317 bits (813), Expect = 3e-85
Identities = 149/200 (74%), Positives = 180/200 (90%)
Frame = -2

Query: 602 QKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDI 423
++ E +T V+CSA PPPAWPGRAV + K+WEGPKP+S++GSTGSIGTQTLDI
Sbjct: 38 KRKENGRTAALRVQCSASAQPPPAWPGRAVANSGHKSWEGPKPISIVGSTGSIGTQTLDI 97

Query: 422 VAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVA 243
VAE+PDKFR+VALAAGSN+TLLADQ++ FKP LV++++ SL+ E++EA+ADL+HKPEI+
Sbjct: 98 VAENPDKFRVVALAAGSNITLLADQIKTFKPELVSVRDESLIDELKEALADLEHKPEIIP 157

Query: 242 GDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAK 63
G++GI+EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA
Sbjct: 158 GEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAH 217

Query: 62 KHNIKILPADSEHSAIFQCI 3
KHN+KILPADSEHSAIFQCI
Sbjct: 218 KHNVKILPADSEHSAIFQCI 237


>tr|B7UCR9|B7UCR9_SALMI 1-deoxy-d-xylulose 5-phosphate
reductoisomerase OS=Salvia miltiorrhiza PE=2 SV=1
Length = 474

Score = 317 bits (811), Expect = 4e-85
Identities = 156/201 (77%), Positives = 179/201 (89%)
Frame = -2

Query: 605 KQKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLD 426
K+K R T + V CSA P PPPAWPGRAV + TWEGPKP+S+IGSTGSIGTQTLD
Sbjct: 38 KRKDSRC-TASKRVHCSAQPPPPPAWPGRAVAEPGRMTWEGPKPISVIGSTGSIGTQTLD 96

Query: 425 IVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIV 246
IVAE+PDKFRIVALAAGSNVTLLADQVR FKP LV++++ SLV E++EA+AD + KPEI+
Sbjct: 97 IVAENPDKFRIVALAAGSNVTLLADQVRAFKPKLVSVRDESLVSELKEALADFEDKPEII 156

Query: 245 AGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLA 66
G++G++EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA
Sbjct: 157 PGEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA 216

Query: 65 KKHNIKILPADSEHSAIFQCI 3
KKHN+KILPADSEHSAIFQCI
Sbjct: 217 KKHNVKILPADSEHSAIFQCI 237


>tr|A7PD04|A7PD04_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016085001
PE=4 SV=1
Length = 471

Score = 316 bits (810), Expect = 6e-85
Identities = 156/202 (77%), Positives = 180/202 (89%)
Frame = -2

Query: 608 VKQKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTL 429
V ++ + T R V CSA P PPPAWPGRAV +KTW+GPKPLS++GSTGSIGTQTL
Sbjct: 33 VLKRKDYGATFGRRVNCSAQP-PPPAWPGRAVPELGRKTWDGPKPLSVVGSTGSIGTQTL 91

Query: 428 DIVAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEI 249
DIVAE+PDKFRIVALAAGSNVTLLADQV+ FKP LVA++N +LV E++EA+AD +HKPEI
Sbjct: 92 DIVAENPDKFRIVALAAGSNVTLLADQVKTFKPQLVAVRNEALVNELKEALADCEHKPEI 151

Query: 248 VAGDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPL 69
+ G++G++EVARHPEAV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPL
Sbjct: 152 IPGEQGVIEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPL 211

Query: 68 AKKHNIKILPADSEHSAIFQCI 3
A KHN+KILPADSEHSAIFQCI
Sbjct: 212 AHKHNVKILPADSEHSAIFQCI 233


>tr|Q6GZ43|Q6GZ43_TAXCU 1-deoxy-D-xylulose-5-phosphate
reductoisomerase OS=Taxus cuspidata PE=2 SV=1
Length = 477

Score = 315 bits (807), Expect = 1e-84
Identities = 153/199 (76%), Positives = 175/199 (87%)
Frame = -2

Query: 599 KGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIV 420
K K R +CS + +PPPAWPG AVV + +K W+GPKP S+IGSTGSIGTQTLDIV
Sbjct: 43 KSRTKKACTRAARCS-IQAPPPAWPGTAVVGEDRKVWDGPKPFSIIGSTGSIGTQTLDIV 101

Query: 419 AEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAG 240
AEHPDKF++VALAAGSNVTLLA+QVR FKP LV+++N SL E++EA+AD++HKPEIV G
Sbjct: 102 AEHPDKFKVVALAAGSNVTLLAEQVRMFKPKLVSVRNESLATELKEALADIEHKPEIVYG 161

Query: 239 DEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKK 60
DEG+VEVA+HPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA K
Sbjct: 162 DEGMVEVAQHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHK 221

Query: 59 HNIKILPADSEHSAIFQCI 3
H +KILPADSEHSAIFQCI
Sbjct: 222 HKVKILPADSEHSAIFQCI 240


>tr|Q2VWR8|Q2VWR8_9CONI 1-deoxy-D-xylulose-5-phosphate
reductoisomerase OS=Taxus x media GN=DXR PE=2 SV=1
Length = 477

Score = 315 bits (807), Expect = 1e-84
Identities = 153/199 (76%), Positives = 175/199 (87%)
Frame = -2

Query: 599 KGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIV 420
K K R +CS + +PPPAWPG AVV + +K W+GPKP S+IGSTGSIGTQTLDIV
Sbjct: 43 KSRTKKACTRAARCS-IQAPPPAWPGTAVVGEDRKVWDGPKPFSIIGSTGSIGTQTLDIV 101

Query: 419 AEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAG 240
AEHPDKF++VALAAGSNVTLLA+QVR FKP LV+++N SL E++EA+AD++HKPEIV G
Sbjct: 102 AEHPDKFKVVALAAGSNVTLLAEQVRMFKPKLVSVRNESLATELKEALADIEHKPEIVYG 161

Query: 239 DEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKK 60
DEG+VEVA+HPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA K
Sbjct: 162 DEGMVEVAQHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHK 221

Query: 59 HNIKILPADSEHSAIFQCI 3
H +KILPADSEHSAIFQCI
Sbjct: 222 HKVKILPADSEHSAIFQCI 240


>tr|A0A1F2|A0A1F2_SALMI 1-deoxy-d-xylulose 5-phosphate
reductoisomerase OS=Salvia miltiorrhiza PE=2 SV=1
Length = 474

Score = 312 bits (800), Expect = 8e-84
Identities = 152/200 (76%), Positives = 176/200 (88%)
Frame = -2

Query: 602 QKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDI 423
+K + T + V CSA P PPPAWPGRAV + TWEGPKP+S+IGSTGSIGT TLDI
Sbjct: 38 KKKDSTCTASKRVHCSAQPPPPPAWPGRAVAEPGRMTWEGPKPISVIGSTGSIGTHTLDI 97

Query: 422 VAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVA 243
AE+PDKFRIVALAAGSNVTLLADQVR FKP LV++++ SLV E++EA+AD + KPEI+
Sbjct: 98 FAENPDKFRIVALAAGSNVTLLADQVRAFKPKLVSVRDESLVSELKEALADFEDKPEIIP 157

Query: 242 GDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAK 63
G++G++EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLAK
Sbjct: 158 GEQGMIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAK 217

Query: 62 KHNIKILPADSEHSAIFQCI 3
KHN+KILPADSEHSAIFQCI
Sbjct: 218 KHNVKILPADSEHSAIFQCI 237


>tr|Q8L6C5|Q8L6C5_STERE 1-deoxy-D-xylulose 5-phosphate
reductoisomerase OS=Stevia rebaudiana GN=dxr PE=2 SV=1
Length = 473

Score = 311 bits (798), Expect = 1e-83
Identities = 148/199 (74%), Positives = 177/199 (88%)
Frame = -2

Query: 599 KGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIV 420
K + K +G++CSA P PPPAWPG A+V K W+GPKP+S++GSTGSIGTQTLDIV
Sbjct: 36 KRKDVKLAGKGIRCSAQPPPPPAWPGTALVDPGTKNWDGPKPISIVGSTGSIGTQTLDIV 95

Query: 419 AEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAG 240
AE+PDKFR+VALAAGSNVTLLA+Q++ FKP LV+I+N SLV E++EA+AD D+ PEI+ G
Sbjct: 96 AENPDKFRVVALAAGSNVTLLAEQIKAFKPQLVSIQNESLVGELKEALADADYMPEIIPG 155

Query: 239 DEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKK 60
D+GI+EVARHP+ V+VVTGIVGCAGLKPTVAAIEAGK+IALANKETLIAGGP+VLPLA+K
Sbjct: 156 DQGIIEVARHPDCVTVVTGIVGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLARK 215

Query: 59 HNIKILPADSEHSAIFQCI 3
HN+KILPADSEHSAIFQCI
Sbjct: 216 HNVKILPADSEHSAIFQCI 234


>tr|Q5J7B3|Q5J7B3_GINBI Putative 1-deoxy-D-xylulose 5-phosphate
reductoisomerase OS=Ginkgo biloba PE=2 SV=1
Length = 477

Score = 311 bits (796), Expect = 2e-83
Identities = 152/190 (80%), Positives = 172/190 (90%)
Frame = -2

Query: 572 RGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDIVAEHPDKFRI 393
R V CS + PPPAWPGRAVV + +K W+GPKP S++GSTGSIGTQTLDIVAEHPDKFR+
Sbjct: 52 RTVNCS-LNGPPPAWPGRAVVDEDRKVWDGPKPFSIVGSTGSIGTQTLDIVAEHPDKFRV 110

Query: 392 VALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVAGDEGIVEVAR 213
VALAAGSNV LLADQVR+FKP LVAI+N SL+ E++ A++D + KPEI++G+EGIVEVAR
Sbjct: 111 VALAAGSNVALLADQVRQFKPKLVAIRNESLITELKAALSDFEPKPEIISGEEGIVEVAR 170

Query: 212 HPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAKKHNIKILPAD 33
HPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA KH +KILPAD
Sbjct: 171 HPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHKVKILPAD 230

Query: 32 SEHSAIFQCI 3
SEHSAIFQCI
Sbjct: 231 SEHSAIFQCI 240


>tr|Q0JRD4|Q0JRD4_ORYSJ cDNA clone:J013075G02, full insert sequence
OS=Oryza sativa subsp. japonica GN=Os01g0106900 PE=2
SV=1
Length = 473

Score = 311 bits (796), Expect = 2e-83
Identities = 149/200 (74%), Positives = 177/200 (88%)
Frame = -2

Query: 602 QKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDI 423
Q +R +R CS +PPPAWPGRAVV +++W+GPKP+S++GSTGSIGTQTLDI
Sbjct: 36 QTRDRRAVSLRRTCCSMQQAPPPAWPGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDI 95

Query: 422 VAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVA 243
VAE+PDKFR+VALAAGSNVTLLADQV+ FKP LVA++N SLV E++EA+AD D KPEI+
Sbjct: 96 VAENPDKFRVVALAAGSNVTLLADQVKTFKPKLVAVRNESLVDELKEALADCDWKPEIIP 155

Query: 242 GDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAK 63
G++G++EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA+
Sbjct: 156 GEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQ 215

Query: 62 KHNIKILPADSEHSAIFQCI 3
KH +KILPADSEHSAIFQCI
Sbjct: 216 KHKVKILPADSEHSAIFQCI 235


>tr|A2WJR2|A2WJR2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00059 PE=4 SV=1
Length = 473

Score = 311 bits (796), Expect = 2e-83
Identities = 149/200 (74%), Positives = 177/200 (88%)
Frame = -2

Query: 602 QKGERAKTLVRGVKCSAVPSPPPAWPGRAVVSDVKKTWEGPKPLSLIGSTGSIGTQTLDI 423
Q +R +R CS +PPPAWPGRAVV +++W+GPKP+S++GSTGSIGTQTLDI
Sbjct: 36 QTRDRRAVSLRRTCCSMQQAPPPAWPGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDI 95

Query: 422 VAEHPDKFRIVALAAGSNVTLLADQVRRFKPSLVAIKNVSLVPEIREAIADLDHKPEIVA 243
VAE+PDKFR+VALAAGSNVTLLADQV+ FKP LVA++N SLV E++EA+AD D KPEI+
Sbjct: 96 VAENPDKFRVVALAAGSNVTLLADQVKTFKPKLVAVRNESLVDELKEALADCDWKPEIIP 155

Query: 242 GDEGIVEVARHPEAVSVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPYVLPLAK 63
G++G++EVARHP+AV+VVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGP+VLPLA+
Sbjct: 156 GEQGVIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQ 215

Query: 62 KHNIKILPADSEHSAIFQCI 3
KH +KILPADSEHSAIFQCI
Sbjct: 216 KHKVKILPADSEHSAIFQCI 235