BP920737
Clone id YMU001_000140_H05
Library
Length 320
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000140_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCCTGAGAAAGAAGATAAGGAAGAAGAAGGGCCAAGGTGAACAGCCTGAAGCGGCACCCT
CTGAGCCTATGCTGTAAGGAGTCGGATGAAGCAACCGGAAGCCTGATCTGAGTTCGACAA
TTCTAAAGACAAGCCATCAAGCGATGATGAAGGCCAAGATGCGAAGAAGAAGACTGCACC
GTCTGAGCCTGGATTTCTGCAACACGCAGATGAACTCGGTGAATGGTCCTGCTTCAACAA
ACGATGGCCAAAGCGCAAAGAACCAAGATGCCGCACCCTCTGAACCACACAATATAGACG
GAGCCAACCAATGTATGATG
■■Homology search results ■■ -
sp_hit_id A4QVI3
Definition sp|A4QVI3|DENR_MAGGR Translation machinery-associated protein 22 OS=Magnaporthe grisea
Align length 59
Score (bit) 26.2
E-value 4.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920737|Adiantum capillus-veneris mRNA, clone:
YMU001_000140_H05.
(320 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A4QVI3|DENR_MAGGR Translation machinery-associated protein 22... 26 4.0
sp|Q2S2N7|RL21_SALRD 50S ribosomal protein L21 OS=Salinibacter r... 30 4.8
sp|Q54YB7|MYBF_DICDI Myb-like protein F OS=Dictyostelium discoid... 30 4.8
sp|Q13601|KRR1_HUMAN KRR1 small subunit processome component hom... 30 4.8
sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM7... 29 8.2
sp|Q8CAF4|NHSL1_MOUSE NHS-like protein 1 OS=Mus musculus GN=Nhsl... 29 8.2

>sp|A4QVI3|DENR_MAGGR Translation machinery-associated protein 22
OS=Magnaporthe grisea GN=TMA22 PE=3 SV=1
Length = 196

Score = 26.2 bits (56), Expect(2) = 4.0
Identities = 18/59 (30%), Positives = 27/59 (45%)
Frame = +2

Query: 83 RMKQPEA*SEFDNSKDKPSSDDEGQDAKKKTAPSEPGFLQHADELGEWSCFNKRWPKRK 259
R+ PEA + + +DAKKK A +E +HAD+L + KR + K
Sbjct: 50 RIWSPEALQAATAALSVEAQQRAEKDAKKKAAKAEAAEAKHADKLKKSVVTVKRIERNK 108



Score = 23.5 bits (49), Expect(2) = 4.0
Identities = 9/10 (90%), Positives = 9/10 (90%)
Frame = +3

Query: 39 EQPEAAPSEP 68
EQPEA PSEP
Sbjct: 5 EQPEAGPSEP 14


>sp|Q2S2N7|RL21_SALRD 50S ribosomal protein L21 OS=Salinibacter
ruber (strain DSM 13855) GN=rplU PE=3 SV=2
Length = 135

Score = 29.6 bits (65), Expect = 4.8
Identities = 13/36 (36%), Positives = 20/36 (55%)
Frame = +3

Query: 177 HRLSLDFCNTQMNSVNGPASTNDGQSAKNQDAAPSE 284
HR + + NGPAS++D ++A+ DA P E
Sbjct: 91 HRQQYTQIEIESLNANGPASSDDEEAAETSDAEPDE 126


>sp|Q54YB7|MYBF_DICDI Myb-like protein F OS=Dictyostelium discoideum
GN=mybF PE=3 SV=1
Length = 564

Score = 29.6 bits (65), Expect = 4.8
Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 10/60 (16%)
Frame = +2

Query: 110 EFDNSKD-----KPSSDDEGQDAKKKTAPSEPG---FLQHADELGE--WSCFNKRWPKRK 259
EF SKD K SSDD+G D+ + T +PG + +EL + ++ + K W K K
Sbjct: 381 EFKESKDSSLKRKSSSDDDGDDSGRDTKKYKPGRTVWTLEEEELYKEVFNHYGKNWKKIK 440


>sp|Q13601|KRR1_HUMAN KRR1 small subunit processome component
homolog OS=Homo sapiens GN=KRR1 PE=1 SV=4
Length = 381

Score = 29.6 bits (65), Expect = 4.8
Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)
Frame = +2

Query: 107 SEFDNSKDKPSSDDEGQDAKKKTAPSEPGFLQHADELG--EWSCFNKRWPKRKE 262
SEF N K KP + DE + EP F + + G E S F +PK +E
Sbjct: 16 SEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYRE 69


>sp|P07213|TOM70_YEAST Mitochondrial import receptor subunit TOM70
OS=Saccharomyces cerevisiae GN=TOM70 PE=1 SV=2
Length = 617

Score = 28.9 bits (63), Expect = 8.2
Identities = 13/25 (52%), Positives = 14/25 (56%)
Frame = +2

Query: 116 DNSKDKPSSDDEGQDAKKKTAPSEP 190
D KD S E + AKK TAPS P
Sbjct: 47 DEKKDTKDSQKETEGAKKSTAPSNP 71


>sp|Q8CAF4|NHSL1_MOUSE NHS-like protein 1 OS=Mus musculus GN=Nhsl1
PE=1 SV=3
Length = 1587

Score = 28.9 bits (63), Expect = 8.2
Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 5/38 (13%)
Frame = +3

Query: 216 SVNGPASTNDGQSA-----KNQDAAPSEPHNIDGANQC 314
S+N PA+ +G A +N + P P ++DG ++C
Sbjct: 501 SLNAPANRENGSQAILYHCRNNPSFPDHPSDVDGKSEC 538


tr_hit_id A3V0U1
Definition tr|A3V0U1|A3V0U1_9RHOB DNA polymerase III subunit alpha OS=Loktanella vestfoldensis SKA53
Align length 40
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920737|Adiantum capillus-veneris mRNA, clone:
YMU001_000140_H05.
(320 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A3V0U1|A3V0U1_9RHOB DNA polymerase III subunit alpha OS=Lokta... 35 2.4
tr|B3L983|B3L983_PLAKH Putative uncharacterized protein OS=Plasm... 27 6.5
tr|Q98PM8|Q98PM8_MYCPU MEMBRANE NUCLEASE OS=Mycoplasma pulmonis ... 33 9.2
tr|B6H2C8|B6H2C8_PENCH Pc13g04790 protein OS=Penicillium chrysog... 33 9.2

>tr|A3V0U1|A3V0U1_9RHOB DNA polymerase III subunit alpha
OS=Loktanella vestfoldensis SKA53 GN=SKA53_08899 PE=4
SV=1
Length = 1188

Score = 34.7 bits (78), Expect = 2.4
Identities = 19/40 (47%), Positives = 22/40 (55%)
Frame = -2

Query: 121 IVELRSGFRLLHPTPYSIGSEGAASGCSPWPFFFLIFFLR 2
IV R G L P P+S G G+ASG +P PF L F R
Sbjct: 859 IVAGREGHPGLDPGPHSAGGPGSASGATPKPFVNLFDFAR 898


>tr|B3L983|B3L983_PLAKH Putative uncharacterized protein
OS=Plasmodium knowlesi (strain H) GN=PKH_123790 PE=4
SV=1
Length = 941

Score = 26.6 bits (57), Expect(2) = 6.5
Identities = 10/33 (30%), Positives = 19/33 (57%)
Frame = +2

Query: 125 KDKPSSDDEGQDAKKKTAPSEPGFLQHADELGE 223
+D+ + G+D+ + AP G++ H +LGE
Sbjct: 170 EDEKDAQAHGEDSVEDEAPGTGGYIVHERDLGE 202



Score = 25.8 bits (55), Expect(2) = 6.5
Identities = 10/16 (62%), Positives = 14/16 (87%)
Frame = +3

Query: 6 RKKIRKKKGQGEQPEA 53
+KK RKKKG+G++ EA
Sbjct: 118 KKKNRKKKGEGDEEEA 133


>tr|Q98PM8|Q98PM8_MYCPU MEMBRANE NUCLEASE OS=Mycoplasma pulmonis
GN=MYPU_6940 PE=4 SV=1
Length = 394

Score = 32.7 bits (73), Expect = 9.2
Identities = 14/58 (24%), Positives = 27/58 (46%)
Frame = +2

Query: 68 YAVRSRMKQPEA*SEFDNSKDKPSSDDEGQDAKKKTAPSEPGFLQHADELGEWSCFNK 241
Y + ++ K+ E+ + DN + + G + K + S P L + LG W+ N+
Sbjct: 27 YQIENKNKKDESNQKNDNQSSQNENPINGDNTNKNNSDSNPNLLLNKIRLGHWNVLNQ 84


>tr|B6H2C8|B6H2C8_PENCH Pc13g04790 protein OS=Penicillium chrysogenum
Wisconsin 54-1255 GN=Pc13g04790 PE=4 SV=1
Length = 3674

Score = 32.7 bits (73), Expect = 9.2
Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
Frame = +2

Query: 86 MKQPEA*SEFDNSKDKPS--SDDEGQDAKKKTAPSEPGFLQHADELGEWSCFNKRWP 250
+++PE E D SKD PS S + + + T PS P L +E G+ C +R P
Sbjct: 3428 IREPELPPEGDKSKDMPSSLSMEPSDERTRPTEPSSPTRLPPREEAGKELCELRRSP 3484