BP920774
Clone id YMU001_000141_D05
Library
Length 528
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000141_D05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCAAAGCAGGTGGACTACATGGTGCGACAGAACTTTACTCCCTGCATCGAGTTCGACAA
CATTGAGAGCGTGTACCGGGAGCACTTCCACGGGAGCGGGTACTACGATGGGAGGTGCTG
GGTGATGTGGAAGCTGCCCATGTTTGGCTGCACCGACTCCGCCGCCGTGCTGCGCGAGAT
CACGGAGTGCGCCAAGGAGTACCCCAAGGCATTCATCCGGGTGCTCGGCTTCGATGCCAA
GCGGCAAGTTCAGGTTGCTGGCTTCCTTGTCCAGAAGCCCGGCCAGTGAAGTAAATTTTT
TCTGCTGCCTCTGAATTTCCCCAGCCCATATATCTAATTTGTTGTGAGCTATCATGAAAG
CCTGTCTGTATAGAAACCTGCTAACTTGGGCGGGGATTCTCTAATTCGTGAGCCCCGGGG
CCCCTTGGAACTCCTTGTCTTGTAAATCAAAACCCAACATCCTGAGCTTGCAAGGCCTGC
TGATGAATGAAAGGTGATCCTGTTATTCTTGGTTCACAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q40250
Definition sp|Q40250|RBS_LACSA Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa
Align length 94
Score (bit) 132.0
E-value 7.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920774|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_D05.
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q40250|RBS_LACSA Ribulose bisphosphate carboxylase small chai... 132 7e-31
sp|Q96542|RBS_BETVE Ribulose bisphosphate carboxylase small chai... 130 5e-30
sp|P10795|RBS1A_ARATH Ribulose bisphosphate carboxylase small ch... 130 5e-30
sp|Q43832|RBS2_SPIOL Ribulose bisphosphate carboxylase small cha... 129 8e-30
sp|P10798|RBS3B_ARATH Ribulose bisphosphate carboxylase small ch... 127 2e-29
sp|P10797|RBS2B_ARATH Ribulose bisphosphate carboxylase small ch... 127 2e-29
sp|P10796|RBS1B_ARATH Ribulose bisphosphate carboxylase small ch... 127 2e-29
sp|Q39743|RBS1_FLAPR Ribulose bisphosphate carboxylase small cha... 127 3e-29
sp|P08135|RBS_RAPSA Ribulose bisphosphate carboxylase small chai... 125 9e-29
sp|P10053|RBS_PINTH Ribulose bisphosphate carboxylase small chai... 125 9e-29
sp|P07089|RBS_FLATR Ribulose bisphosphate carboxylase small chai... 125 2e-28
sp|Q39749|RBS7_FLAPR Ribulose bisphosphate carboxylase small cha... 125 2e-28
sp|Q39747|RBS5_FLAPR Ribulose bisphosphate carboxylase small cha... 125 2e-28
sp|Q39746|RBS4_FLAPR Ribulose bisphosphate carboxylase small cha... 125 2e-28
sp|Q39745|RBS3_FLAPR Ribulose bisphosphate carboxylase small cha... 125 2e-28
sp|Q39744|RBS2_FLAPR Ribulose bisphosphate carboxylase small cha... 125 2e-28
sp|O48550|RBS_ZANAE Ribulose bisphosphate carboxylase small chai... 124 3e-28
sp|P27985|RBS2_BRANA Ribulose bisphosphate carboxylase small cha... 124 3e-28
sp|P05346|RBS1_BRANA Ribulose bisphosphate carboxylase small cha... 124 3e-28
sp|Q40004|RBS_HORVU Ribulose bisphosphate carboxylase small chai... 124 3e-28
sp|P26667|RBS2_WHEAT Ribulose bisphosphate carboxylase small cha... 124 3e-28
sp|P00871|RBS1_WHEAT Ribulose bisphosphate carboxylase small cha... 124 3e-28
sp|P08705|RBS_HELAN Ribulose bisphosphate carboxylase small chai... 123 4e-28
sp|Q39748|RBS6_FLAPR Ribulose bisphosphate carboxylase small cha... 123 4e-28
sp|P07398|RBS3_WHEAT Ribulose bisphosphate carboxylase small cha... 123 6e-28
sp|P24007|RBS_PYRPY Ribulose bisphosphate carboxylase small chai... 122 8e-28
sp|Q02980|RBS_MALSP Ribulose bisphosphate carboxylase small chai... 122 1e-27
sp|O22573|RBS3_FRIAG Ribulose bisphosphate carboxylase small cha... 122 1e-27
sp|P18566|RBS2_ORYSJ Ribulose bisphosphate carboxylase small cha... 122 1e-27
sp|O22572|RBS2_FRIAG Ribulose bisphosphate carboxylase small cha... 122 1e-27

>sp|Q40250|RBS_LACSA Ribulose bisphosphate carboxylase small chain,
chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1
Length = 181

Score = 132 bits (333), Expect = 7e-31
Identities = 58/94 (61%), Positives = 71/94 (75%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
+K++DY++R + PC+EF+ VYREH H GYYDGR W MWKLPMFGCTDSA V++E
Sbjct: 84 SKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKE 143

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIRV+GFD RQVQ F+V KP
Sbjct: 144 VGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKP 177


>sp|Q96542|RBS_BETVE Ribulose bisphosphate carboxylase small chain,
chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1
Length = 182

Score = 130 bits (326), Expect = 5e-30
Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R+N PC+EF+ VYREH GYYDGR W MWKLPMFGC DS+ VL+E
Sbjct: 86 AKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKE 145

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC K YP AFIR++GFD KRQVQ+ F+ KP
Sbjct: 146 LEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKP 179


>sp|P10795|RBS1A_ARATH Ribulose bisphosphate carboxylase small chain
1A, chloroplastic OS=Arabidopsis thaliana GN=RBCS-1A
PE=1 SV=2
Length = 180

Score = 130 bits (326), Expect = 5e-30
Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYREH + GYYDGR W MWKLP+FGCTDSA VL+E
Sbjct: 82 AKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKE 141

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIR++GFD RQVQ F+ KP
Sbjct: 142 VEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP 175


>sp|Q43832|RBS2_SPIOL Ribulose bisphosphate carboxylase small chain
2, chloroplastic OS=Spinacia oleracea GN=RBCS2 PE=1 SV=1
Length = 180

Score = 129 bits (324), Expect = 8e-30
Identities = 56/94 (59%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
A+QVDY++ + PC+EF+ VYREH + GYYDGR W MWKLPMFGCTD A VL E
Sbjct: 84 ARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNE 143

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIR++GFD+ RQVQ F+ KP
Sbjct: 144 LEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP 177


>sp|P10798|RBS3B_ARATH Ribulose bisphosphate carboxylase small chain
3B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-3B
PE=1 SV=2
Length = 181

Score = 127 bits (320), Expect = 2e-29
Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYREH + GYYDGR W MWKLP+FGCTDSA VL+E
Sbjct: 82 AKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKE 141

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIR++GFD RQVQ F+ KP
Sbjct: 142 VEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP 175


>sp|P10797|RBS2B_ARATH Ribulose bisphosphate carboxylase small chain
2B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-2B
PE=2 SV=2
Length = 181

Score = 127 bits (320), Expect = 2e-29
Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYREH + GYYDGR W MWKLP+FGCTDSA VL+E
Sbjct: 82 AKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKE 141

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIR++GFD RQVQ F+ KP
Sbjct: 142 VEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP 175


>sp|P10796|RBS1B_ARATH Ribulose bisphosphate carboxylase small chain
1B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-1B
PE=1 SV=1
Length = 181

Score = 127 bits (320), Expect = 2e-29
Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYREH + GYYDGR W MWKLP+FGCTDSA VL+E
Sbjct: 82 AKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKE 141

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIR++GFD RQVQ F+ KP
Sbjct: 142 VEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP 175


>sp|Q39743|RBS1_FLAPR Ribulose bisphosphate carboxylase small chain
1, chloroplastic OS=Flaveria pringlei GN=RBCS1 PE=2 SV=1
Length = 173

Score = 127 bits (319), Expect = 3e-29
Identities = 56/95 (58%), Positives = 71/95 (74%), Gaps = 1/95 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYRE+ GYYDGR W MWKLPMFGCTDSA V++E
Sbjct: 77 AKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKE 136

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKPG 283
+ EC KEYP+A+IR++GFD RQVQ F+ KPG
Sbjct: 137 LQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPG 171


>sp|P08135|RBS_RAPSA Ribulose bisphosphate carboxylase small chain,
chloroplastic OS=Raphanus sativus GN=RBCS PE=2 SV=1
Length = 181

Score = 125 bits (315), Expect = 9e-29
Identities = 56/94 (59%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
AK+VDY++R + PC+EF+ VYREH GYYDGR W MWKLP+FGCTDSA VL+E
Sbjct: 82 AKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKE 141

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP A IR++GFD RQVQ F+ KP
Sbjct: 142 VQECKKEYPNALIRIIGFDNNRQVQCISFIAYKP 175


>sp|P10053|RBS_PINTH Ribulose bisphosphate carboxylase small chain,
chloroplastic OS=Pinus thunbergii GN=RBCS PE=2 SV=1
Length = 171

Score = 125 bits (315), Expect = 9e-29
Identities = 54/92 (58%), Positives = 70/92 (76%)
Frame = +2

Query: 5 KQVDYMVRQNFTPCIEFDNIESVYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLREIT 184
K+V+Y++R + PC+EFD S+ R++ GYYDGR WVMWKLPMFGCT+++ V+ E+
Sbjct: 79 KEVEYLLRNKWVPCLEFDLEGSISRKYNRSPGYYDGRYWVMWKLPMFGCTEASQVINEVR 138

Query: 185 ECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
ECAK YPKAFIRV+GFD RQVQ F+V KP
Sbjct: 139 ECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170


tr_hit_id Q43110
Definition tr|Q43110|Q43110_PTEVI Ribulose bisphosphate carboxylase small chain OS=Pteris vittata
Align length 95
Score (bit) 177.0
E-value 3.0e-43
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920774|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_D05.
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q43110|Q43110_PTEVI Ribulose bisphosphate carboxylase small c... 177 3e-43
tr|Q9SXH1|Q9SXH1_PHYPA Ribulose bisphosphate carboxylase small c... 140 3e-32
tr|A9TCL7|A9TCL7_PHYPA Ribulose bisphosphate carboxylase small c... 140 3e-32
tr|A9TT85|A9TT85_PHYPA Ribulose bisphosphate carboxylase small c... 140 4e-32
tr|A9T3X7|A9T3X7_PHYPA Ribulose bisphosphate carboxylase small c... 139 6e-32
tr|A9T3W5|A9T3W5_PHYPA Ribulose bisphosphate carboxylase small c... 139 6e-32
tr|Q75WT7|Q75WT7_PHYPA Ribulose bisphosphate carboxylase small c... 138 1e-31
tr|Q9SEB9|Q9SEB9_LACSA Ribulose bisphosphate carboxylase small c... 135 2e-30
tr|A9S3R8|A9S3R8_PHYPA Ribulose bisphosphate carboxylase small c... 132 8e-30
tr|A9TWU8|A9TWU8_PHYPA Ribulose bisphosphate carboxylase small c... 130 3e-29
tr|A9TKI7|A9TKI7_PHYPA Ribulose bisphosphate carboxylase small c... 130 3e-29
tr|A9RJ57|A9RJ57_PHYPA Ribulose bisphosphate carboxylase small c... 130 4e-29
tr|Q0WVH4|Q0WVH4_ARATH Ribulose bisphosphate carboxylase small c... 130 5e-29
tr|Q3LFQ4|Q3LFQ4_PANGI Ribulose bisphosphate carboxylase small c... 129 9e-29
tr|O20253|O20253_SPIOL Ribulose bisphosphate carboxylase small c... 129 9e-29
tr|A9PI67|A9PI67_POPTR Ribulose bisphosphate carboxylase small c... 129 1e-28
tr|A9TVU8|A9TVU8_PHYPA Ribulose bisphosphate carboxylase small c... 128 1e-28
tr|A9U4X8|A9U4X8_PHYPA Ribulose bisphosphate carboxylase small c... 128 2e-28
tr|A9U4X7|A9U4X7_PHYPA Ribulose bisphosphate carboxylase small c... 128 2e-28
tr|A5PJI4|A5PJI4_BOVIN Putative uncharacterized protein OS=Bos t... 128 2e-28
tr|A9TYN7|A9TYN7_PHYPA Ribulose bisphosphate carboxylase small c... 127 3e-28
tr|A7LIT5|A7LIT5_9ROSI Ribulose bisphosphate carboxylase small c... 127 4e-28
tr|A0FIP7|A0FIP7_CAMSI Ribulose bisphosphate carboxylase small c... 126 6e-28
tr|A9S8M9|A9S8M9_PHYPA Ribulose bisphosphate carboxylase small c... 126 7e-28
tr|A9S8M6|A9S8M6_PHYPA Ribulose bisphosphate carboxylase small c... 126 7e-28
tr|Q9ZWG3|Q9ZWG3_9POAL Ribulose bisphosphate carboxylase small c... 125 1e-27
tr|Q9AQX3|Q9AQX3_FLAPA Ribulose bisphosphate carboxylase small c... 125 1e-27
tr|Q84NG5|Q84NG5_FLABI Ribulose bisphosphate carboxylase small c... 125 1e-27
tr|Q84NG4|Q84NG4_FLABI Ribulose bisphosphate carboxylase small c... 125 1e-27
tr|B3H5S2|B3H5S2_ARATH Uncharacterized protein At5g38410.3 OS=Ar... 125 1e-27

>tr|Q43110|Q43110_PTEVI Ribulose bisphosphate carboxylase small
chain OS=Pteris vittata GN=rbcS4 PE=3 SV=1
Length = 174

Score = 177 bits (449), Expect = 3e-43
Identities = 81/95 (85%), Positives = 87/95 (91%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLREI 181
AKQV+YMVR+ +TPCIEFD I SVYREHFHGSGYYDGR W+MWKLPMFGCTDS +VLREI
Sbjct: 80 AKQVEYMVRKGWTPCIEFDTIGSVYREHFHGSGYYDGRYWIMWKLPMFGCTDSGSVLREI 139

Query: 182 TECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKPGQ 286
ECAKEYP AFIRVLGFDAKRQVQVAGFLV+KP Q
Sbjct: 140 AECAKEYPTAFIRVLGFDAKRQVQVAGFLVKKPSQ 174


>tr|Q9SXH1|Q9SXH1_PHYPA Ribulose bisphosphate carboxylase small
chain (Fragment) OS=Physcomitrella patens PE=2 SV=1
Length = 214

Score = 140 bits (354), Expect = 3e-32
Identities = 63/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHG---SGYYDGRCWVMWKLPMFGCTDSAAVL 172
AKQVDYM++QN PCIEFD + SV R +F G SGYYDGR W MWKLPMFGCTDS+ VL
Sbjct: 118 AKQVDYMIQQNLIPCIEFDTVGSVSRTNFSGAGSSGYYDGRYWTMWKLPMFGCTDSSQVL 177

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC ++P ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 178 REIQECKSQFPSCWVRVLGFDSKKQVQICGFLVSRP 213


>tr|A9TCL7|A9TCL7_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_221004 PE=3 SV=1
Length = 184

Score = 140 bits (354), Expect = 3e-32
Identities = 63/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHG---SGYYDGRCWVMWKLPMFGCTDSAAVL 172
AKQVDYM++QN PCIEFD + SV R +F G SGYYDGR W MWKLPMFGCTDS+ VL
Sbjct: 88 AKQVDYMIQQNLIPCIEFDTVGSVSRTNFSGAGSSGYYDGRYWTMWKLPMFGCTDSSQVL 147

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC ++P ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 148 REIQECKSQFPSCWVRVLGFDSKKQVQICGFLVSRP 183


>tr|A9TT85|A9TT85_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_225236 PE=3 SV=1
Length = 183

Score = 140 bits (353), Expect = 4e-32
Identities = 63/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHG---SGYYDGRCWVMWKLPMFGCTDSAAVL 172
AKQVDYM++QN PCIEFD + SV R +F G SGYYDGR W MWKLPMFGCTDS+ VL
Sbjct: 87 AKQVDYMIQQNLIPCIEFDTVGSVSRTNFSGAGSSGYYDGRYWTMWKLPMFGCTDSSQVL 146

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC ++P ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 147 REIQECKTQFPSCWVRVLGFDSKKQVQICGFLVSRP 182


>tr|A9T3X7|A9T3X7_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_87752 PE=3 SV=1
Length = 179

Score = 139 bits (351), Expect = 6e-32
Identities = 63/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHG---SGYYDGRCWVMWKLPMFGCTDSAAVL 172
AKQVD+M++QN PCIEFD + SV R +F G SGYYDGR W MWKLPMFGCTDSA VL
Sbjct: 83 AKQVDFMIQQNLIPCIEFDTVGSVSRTNFSGPGSSGYYDGRYWTMWKLPMFGCTDSAQVL 142

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC + +P ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 143 REIQECKQSFPSCWVRVLGFDSKKQVQICGFLVARP 178


>tr|A9T3W5|A9T3W5_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_87740 PE=3 SV=1
Length = 179

Score = 139 bits (351), Expect = 6e-32
Identities = 63/96 (65%), Positives = 76/96 (79%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHG---SGYYDGRCWVMWKLPMFGCTDSAAVL 172
AKQVD+M++QN PCIEFD + SV R +F G SGYYDGR W MWKLPMFGCTDSA VL
Sbjct: 83 AKQVDFMIQQNLIPCIEFDTVGSVSRTNFSGPGSSGYYDGRYWTMWKLPMFGCTDSAQVL 142

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC + +P ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 143 REIQECKQSFPSCWVRVLGFDSKKQVQICGFLVARP 178


>tr|Q75WT7|Q75WT7_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens GN=PprbcS1
PE=2 SV=1
Length = 184

Score = 138 bits (348), Expect = 1e-31
Identities = 62/96 (64%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHGSG---YYDGRCWVMWKLPMFGCTDSAAVL 172
A+QVDYM++QN PCIEFD + +V R +F GSG YYDGR W MWKLPMFGCTDS+ VL
Sbjct: 88 ARQVDYMIQQNLIPCIEFDTVGAVSRTNFSGSGSSGYYDGRYWTMWKLPMFGCTDSSQVL 147

Query: 173 REITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
REI EC YP ++RVLGFD+K+QVQ+ GFLV +P
Sbjct: 148 REIQECKTSYPSCWVRVLGFDSKKQVQICGFLVARP 183


>tr|Q9SEB9|Q9SEB9_LACSA Ribulose bisphosphate carboxylase small
chain OS=Lactuca sativa PE=2 SV=1
Length = 181

Score = 135 bits (339), Expect = 2e-30
Identities = 58/94 (61%), Positives = 72/94 (76%), Gaps = 1/94 (1%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIES-VYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLRE 178
+K++DY++R + PC+EF+ VYREH H GYYDGR W MWKLPMFGCTDSA V++E
Sbjct: 84 SKEIDYLIRNKWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKE 143

Query: 179 ITECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
+ EC KEYP AFIRV+GFD+ RQVQ F+V KP
Sbjct: 144 VGECKKEYPNAFIRVIGFDSVRQVQCISFIVSKP 177


>tr|A9S3R8|A9S3R8_PHYPA Ribulose bisphosphate carboxylase small
chain OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_123666 PE=3 SV=1
Length = 181

Score = 132 bits (333), Expect = 8e-30
Identities = 59/93 (63%), Positives = 70/93 (75%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLREI 181
AKQV+YM++Q PC+EFDN + V RE+ GYYDGR W MWKLPMFGC DSA VLREI
Sbjct: 88 AKQVEYMIQQKLIPCLEFDNSKGVTRENNSSPGYYDGRYWTMWKLPMFGCQDSAQVLREI 147

Query: 182 TECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
EC K +P F+RVLGFD +QVQ+ GFLV +P
Sbjct: 148 EECKKTFPGCFVRVLGFDNVKQVQICGFLVARP 180


>tr|A9TWU8|A9TWU8_PHYPA Ribulose bisphosphate carboxylase small
chain (Fragment) OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_152025 PE=3 SV=1
Length = 183

Score = 130 bits (328), Expect = 3e-29
Identities = 58/93 (62%), Positives = 68/93 (73%)
Frame = +2

Query: 2 AKQVDYMVRQNFTPCIEFDNIESVYREHFHGSGYYDGRCWVMWKLPMFGCTDSAAVLREI 181
AKQV+YM++Q PC+EFDN V R + GYYDGR W MWKLPMFGC DSA VLREI
Sbjct: 90 AKQVEYMIQQKLIPCLEFDNANGVSRTNNSSPGYYDGRYWTMWKLPMFGCNDSAQVLREI 149

Query: 182 TECAKEYPKAFIRVLGFDAKRQVQVAGFLVQKP 280
EC K +P F+RVLGFD +QVQ+ GFLV +P
Sbjct: 150 EECKKTFPGCFVRVLGFDNVKQVQICGFLVARP 182