BP920792
Clone id YMU001_000141_F07
Library
Length 314
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000141_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCTCCACAACATCAAACTTCAACAATCAATCAACTTATTTCGGTACTAACAAATGCTTTA
CCTGTAAGATCAGCACTATCACTCTAAGCCTGCCTGGTATTCCAAATCCCTTCAAAATGT
GGCTGGCAACCAATCCCACAGTTGAAGTTGCAGCAAGCACAAGTTAAGAAGCACAAATAA
CAAGAAAAATTCATCAATCTAGTACGATCCCTAAAGTTTCAGACACTAGGAGGACTTTTG
TCCTACCATAAAACTAGTGGTTTTCACAAACCGTTCATCCAGTGAGTGGCAAGGCTCCCA
TAACCATAAAGCCA
■■Homology search results ■■ -
sp_hit_id Q38PU2
Definition sp|Q38PU2|GRIK3_MACFA Glutamate receptor, ionotropic kainate 3 OS=Macaca fascicularis
Align length 60
Score (bit) 32.0
E-value 0.98
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920792|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_F07.
(314 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q38PU2|GRIK3_MACFA Glutamate receptor, ionotropic kainate 3 O... 32 0.98
sp|Q13003|GRIK3_HUMAN Glutamate receptor, ionotropic kainate 3 O... 32 0.98
sp|Q38PU4|GRIK1_MACFA Glutamate receptor, ionotropic kainate 1 O... 31 1.7
sp|P39086|GRIK1_HUMAN Glutamate receptor, ionotropic kainate 1 O... 31 1.7
sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus ... 30 2.9
sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo... 30 2.9
sp|P56101|CSP_TORCA Cysteine string protein OS=Torpedo californi... 30 2.9
sp|O42196|CSP_XENLA Cysteine string protein OS=Xenopus laevis GN... 30 3.7
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos ... 29 6.4
sp|P42264|GRIK3_RAT Glutamate receptor, ionotropic kainate 3 OS=... 29 8.3

>sp|Q38PU2|GRIK3_MACFA Glutamate receptor, ionotropic kainate 3
OS=Macaca fascicularis GN=GRIK3 PE=2 SV=1
Length = 919

Score = 32.0 bits (71), Expect = 0.98
Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
Frame = +1

Query: 106 IPSKCGWQPIPQLKLQQAQVKKHK*QE---KFINLVRSLKFQTLGGLLSYHKTSGFHKPF 276
I S C +Q PQ+ + Q +HK +F+N ++ +++ L G + ++KTSG F
Sbjct: 332 IVSVC-YQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDF 390


>sp|Q13003|GRIK3_HUMAN Glutamate receptor, ionotropic kainate 3
OS=Homo sapiens GN=GRIK3 PE=1 SV=3
Length = 919

Score = 32.0 bits (71), Expect = 0.98
Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
Frame = +1

Query: 106 IPSKCGWQPIPQLKLQQAQVKKHK*QE---KFINLVRSLKFQTLGGLLSYHKTSGFHKPF 276
I S C +Q PQ+ + Q +HK +F+N ++ +++ L G + ++KTSG F
Sbjct: 332 IVSVC-YQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDF 390


>sp|Q38PU4|GRIK1_MACFA Glutamate receptor, ionotropic kainate 1
OS=Macaca fascicularis GN=GRIK1 PE=2 SV=1
Length = 918

Score = 31.2 bits (69), Expect = 1.7
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
Frame = +1

Query: 139 QLKLQQAQVKKHK*QE---KFINLVRSLKFQTLGGLLSYHKTSGFHKPF 276
QL + Q +HK +F+NL++ ++ L G ++++KT+G K F
Sbjct: 340 QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDF 388


>sp|P39086|GRIK1_HUMAN Glutamate receptor, ionotropic kainate 1
OS=Homo sapiens GN=GRIK1 PE=2 SV=1
Length = 918

Score = 31.2 bits (69), Expect = 1.7
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
Frame = +1

Query: 139 QLKLQQAQVKKHK*QE---KFINLVRSLKFQTLGGLLSYHKTSGFHKPF 276
QL + Q +HK +F+NL++ ++ L G ++++KT+G K F
Sbjct: 340 QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDF 388


>sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus
musculus GN=Dnajc5b PE=2 SV=1
Length = 199

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/21 (52%), Positives = 12/21 (57%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQP 120
CY C C CCN CG C+P
Sbjct: 123 CYFCCCLCCCCNCCCG-HCRP 142


>sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo
sapiens GN=DNAJC5B PE=2 SV=2
Length = 199

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/21 (52%), Positives = 12/21 (57%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQP 120
CY C C CCN CG C+P
Sbjct: 123 CYFCCCLCCCCNCCCG-HCRP 142


>sp|P56101|CSP_TORCA Cysteine string protein OS=Torpedo californica
PE=1 SV=1
Length = 195

Score = 30.4 bits (67), Expect = 2.9
Identities = 11/21 (52%), Positives = 12/21 (57%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQP 120
CY C C CCN CG C+P
Sbjct: 119 CYFCCCLCCCCNCCCG-KCKP 138


>sp|O42196|CSP_XENLA Cysteine string protein OS=Xenopus laevis
GN=csp PE=2 SV=1
Length = 197

Score = 30.0 bits (66), Expect = 3.7
Identities = 11/21 (52%), Positives = 12/21 (57%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQP 120
CY C C CCN CG C+P
Sbjct: 119 CYCCCCLCCCCNCCCG-KCKP 138


>sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos
taurus GN=DNAJC5B PE=2 SV=1
Length = 199

Score = 29.3 bits (64), Expect = 6.4
Identities = 9/16 (56%), Positives = 9/16 (56%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCG 135
CY C C CCN CG
Sbjct: 123 CYFCCCLCCCCNCCCG 138


>sp|P42264|GRIK3_RAT Glutamate receptor, ionotropic kainate 3
OS=Rattus norvegicus GN=Grik3 PE=1 SV=1
Length = 919

Score = 28.9 bits (63), Expect = 8.3
Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
Frame = +1

Query: 106 IPSKCGWQPIPQLKLQQAQVKKHK*QE---KFINLVRSLKFQTLGGLLSYHKTSGFHKPF 276
I S C +Q Q+ + Q +HK +F+N ++ +++ L G + ++KTSG F
Sbjct: 332 IVSVC-YQRASQMTVNSLQCHRHKPWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDF 390


tr_hit_id B6NBI5
Definition tr|B6NBI5|B6NBI5_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae
Align length 24
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920792|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_F07.
(314 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6NBI5|B6NBI5_BRAFL Putative uncharacterized protein OS=Branc... 35 1.9
tr|A0DL37|A0DL37_PARTE Chromosome undetermined scaffold_55, whol... 35 1.9
tr|B7QNC9|B7QNC9_IXOSC Cysteine string protein, putative OS=Ixod... 35 2.5
tr|Q1HQF6|Q1HQF6_AEDAE Cysteine string protein (Putative unchara... 34 4.2
tr|A0CNX1|A0CNX1_PARTE Chromosome undetermined scaffold_223, who... 33 5.5
tr|A1CAP5|A1CAP5_ASPCL Origin recognition complex subunit 2, put... 33 7.1

>tr|B6NBI5|B6NBI5_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_126920 PE=4 SV=1
Length = 204

Score = 35.0 bits (79), Expect = 1.9
Identities = 14/24 (58%), Positives = 15/24 (62%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQPHFE 111
CYLC C CCNF CG C+P E
Sbjct: 123 CYLCCCFCCCCNFCCG-KCKPRPE 145


>tr|A0DL37|A0DL37_PARTE Chromosome undetermined scaffold_55, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00018071001 PE=4 SV=1
Length = 2665

Score = 35.0 bits (79), Expect = 1.9
Identities = 14/31 (45%), Positives = 18/31 (58%)
Frame = -1

Query: 218 NFRDRTRLMNFSCYLCFLTCACCNFNCGIGC 126
+ + + L N SC LCFL C CN + IGC
Sbjct: 1359 DIKQQITLQNTSCKLCFLNCEICNEDTCIGC 1389


>tr|B7QNC9|B7QNC9_IXOSC Cysteine string protein, putative OS=Ixodes
scapularis GN=IscW_ISCW015127 PE=4 SV=1
Length = 371

Score = 34.7 bits (78), Expect = 2.5
Identities = 13/21 (61%), Positives = 14/21 (66%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQP 120
CYLC C CCNF CG C+P
Sbjct: 265 CYLCCCFCCCCNFCCG-KCKP 284


>tr|Q1HQF6|Q1HQF6_AEDAE Cysteine string protein (Putative
uncharacterized protein) OS=Aedes aegypti GN=AAEL001569
PE=2 SV=1
Length = 177

Score = 33.9 bits (76), Expect = 4.2
Identities = 12/22 (54%), Positives = 12/22 (54%)
Frame = -1

Query: 182 CYLCFLTCACCNFNCGIGCQPH 117
CY C C CCNF CG PH
Sbjct: 116 CYCCCCCCCCCNFCCGKYKPPH 137


>tr|A0CNX1|A0CNX1_PARTE Chromosome undetermined scaffold_223, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00038757001 PE=4 SV=1
Length = 3167

Score = 33.5 bits (75), Expect = 5.5
Identities = 14/24 (58%), Positives = 15/24 (62%)
Frame = -1

Query: 197 LMNFSCYLCFLTCACCNFNCGIGC 126
L N SC LCFL C CN + IGC
Sbjct: 1844 LQNTSCKLCFLNCEICNEDNCIGC 1867


>tr|A1CAP5|A1CAP5_ASPCL Origin recognition complex subunit 2,
putative OS=Aspergillus clavatus GN=ACLA_012410 PE=4
SV=1
Length = 558

Score = 33.1 bits (74), Expect = 7.1
Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)
Frame = +1

Query: 10 HQTSTINQLISVLTNALPVRSALSL*ACLVF-----QIPSKCGWQPIPQLKLQQAQVKKH 174
H+ S+ I V+ P S S+ A +V IPSK G+QP+ L+L Q+ +K
Sbjct: 283 HRQSSAPPSIVVVNGHTPNMSIRSIFATIVTAVLGADIPSKMGFQPVEVLELLQSALKSR 342

Query: 175 K*QEKFINLVRSLKFQTL 228
Q+ L+ S+ +L
Sbjct: 343 PSQKPITVLINSIDAPSL 360