BP920794
Clone id YMU001_000141_F11
Library
Length 484
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000141_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTCCAGTTCTTGTATATTAATTTTCAGCCTTTGGTTGTCTTCTGATGTTGT
TCCCCCTCTTACAATTAGATCATTTTCTTCTCGTACCTGCAGCTCAAGTCTTGCCTCGGA
GTGCTTTTCCAGTAGAACAGAACGTACAACTGCATACTTGGCAGCTGGATCGTACACTCG
ACTTGGAAGGACCAGGTTTAAACGGGTAGCCCCAACAAGTAGCCATACTCTTCCATAAAG
AGAGCGAATACCTGTAGAACTAGACTCCCGGCCAGACTGGCAATATAGCCAATCCAAACA
GAGACTAACATGTGAATCAATAAAAGTAACAAATCTTTTATCGGACGATTTCTTGAGAAA
AGCTTTAAGACGTTGAATTTCATCCTCAAGTTTGCCACGATCACCCTGCACTACCTTTGT
ATGCAAATATCCTAACAAAGAATGTATCTGGGCTGCATCATCTCTTATGAATGTCTTCGT
AAAG
■■Homology search results ■■ -
sp_hit_id Q869L3
Definition sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum
Align length 123
Score (bit) 46.2
E-value 7.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920794|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_F11.
(473 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1... 46 7e-05
sp|Q08014|MEDB_GIALA Median body protein OS=Giardia lamblia PE=2... 32 1.9
sp|P06756|ITAV_HUMAN Integrin alpha-V OS=Homo sapiens GN=ITGAV P... 30 7.1
sp|P80746|ITAV_BOVIN Integrin alpha-V OS=Bos taurus GN=ITGAV PE=... 30 7.1
sp|Q9HMA9|AUBA_HALSA RNA-binding protein AU-1 OS=Halobacterium s... 30 7.1
sp|B0R8A2|AUBA_HALS3 RNA-binding protein AU-1 OS=Halobacterium s... 30 7.1
sp|P33891|TIP20_YEAST Protein transport protein TIP20 OS=Sacchar... 29 9.3
sp|Q7U6V9|SYFB_SYNPX Phenylalanyl-tRNA synthetase beta chain OS=... 29 9.3
sp|Q4ZNY7|MRAY_PSEU2 Phospho-N-acetylmuramoyl-pentapeptide-trans... 29 9.3
sp|Q87WY2|MRAY_PSESM Phospho-N-acetylmuramoyl-pentapeptide-trans... 29 9.3
sp|Q48EF5|MRAY_PSE14 Phospho-N-acetylmuramoyl-pentapeptide-trans... 29 9.3
sp|P43406|ITAV_MOUSE Integrin alpha-V OS=Mus musculus GN=Itgav P... 29 9.3
sp|Q8IBG1|DYHC1_PLAF7 Dynein heavy chain-like protein MAL7P1.162... 29 9.3

>sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3
SV=2
Length = 5900

Score = 46.2 bits (108), Expect = 7e-05
Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 2/123 (1%)
Frame = -2

Query: 376 EDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRE--SSSTGIRSLYGRVWLLV 203
++ I+ +K + +S+DK F + CLD L C + ++S +GR+ LL+
Sbjct: 3398 DELIENIKELIIQSNDKSFNEKSKQLLLPCLDILLCLDDKVLYKDELKLQSTFGRLQLLL 3457

Query: 202 GATRLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREENDLIVRGGTTSEDNQRL 23
RL + +PS DP KY V+ E + + E+++R I+ T +D L
Sbjct: 3458 NTFRLIMFVPSGSIDPTQKYDVILQYSKEHSKQLQDEIEIR----TIIEKQYTGKDGTSL 3513

Query: 22 KIN 14
I+
Sbjct: 3514 VID 3516


>sp|Q08014|MEDB_GIALA Median body protein OS=Giardia lamblia PE=2
SV=1
Length = 857

Score = 31.6 bits (70), Expect = 1.9
Identities = 13/35 (37%), Positives = 25/35 (71%)
Frame = -2

Query: 106 EARLELQVREENDLIVRGGTTSEDNQRLKINIQEL 2
+ARL+ Q++E +D ++ +DN+RLK+ ++EL
Sbjct: 732 KARLQEQLKEMSDKLIEFEMIMDDNRRLKLQVKEL 766


>sp|P06756|ITAV_HUMAN Integrin alpha-V OS=Homo sapiens GN=ITGAV PE=1
SV=2
Length = 1048

Score = 29.6 bits (65), Expect = 7.1
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 12/65 (18%)
Frame = -3

Query: 366 FNVLKLFSRNRPIKDXXXXLI------------HMLVSVWIGYIASLAGSLVLQVFALFM 223
FNV++ +N PI+D + M V VW+ +A LAG L+L V M
Sbjct: 956 FNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVM 1015

Query: 222 EEYGY 208
G+
Sbjct: 1016 YRMGF 1020


>sp|P80746|ITAV_BOVIN Integrin alpha-V OS=Bos taurus GN=ITGAV PE=1
SV=3
Length = 1048

Score = 29.6 bits (65), Expect = 7.1
Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 12/65 (18%)
Frame = -3

Query: 366 FNVLKLFSRNRPIKDXXXXLI------------HMLVSVWIGYIASLAGSLVLQVFALFM 223
FNV++ +N PI+D + M V VW+ +A LAG L+L V M
Sbjct: 956 FNVIEFPYKNLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVM 1015

Query: 222 EEYGY 208
G+
Sbjct: 1016 YRMGF 1020


>sp|Q9HMA9|AUBA_HALSA RNA-binding protein AU-1 OS=Halobacterium
salinarium GN=aubA PE=3 SV=1
Length = 471

Score = 29.6 bits (65), Expect = 7.1
Identities = 18/64 (28%), Positives = 32/64 (50%)
Frame = -2

Query: 196 TRLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREENDLIVRGGTTSEDNQRLKI 17
T LN+ P V+ A +Y + ++ KH++ +E+ REE V G SE+ +
Sbjct: 401 TYLNVCTPVEVFPDAVRYVDLHVDVI-KHADGAVEIVDREELQDCVADGLVSEELAEKAL 459

Query: 16 NIQE 5
++ E
Sbjct: 460 SVAE 463


>sp|B0R8A2|AUBA_HALS3 RNA-binding protein AU-1 OS=Halobacterium
salinarum (strain ATCC 29341 / DSM 671 / R1) GN=aubA
PE=3 SV=1
Length = 471

Score = 29.6 bits (65), Expect = 7.1
Identities = 18/64 (28%), Positives = 32/64 (50%)
Frame = -2

Query: 196 TRLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREENDLIVRGGTTSEDNQRLKI 17
T LN+ P V+ A +Y + ++ KH++ +E+ REE V G SE+ +
Sbjct: 401 TYLNVCTPVEVFPDAVRYVDLHVDVI-KHADGAVEIVDREELQDCVADGLVSEELAEKAL 459

Query: 16 NIQE 5
++ E
Sbjct: 460 SVAE 463


>sp|P33891|TIP20_YEAST Protein transport protein TIP20
OS=Saccharomyces cerevisiae GN=TIP20 PE=1 SV=1
Length = 701

Score = 29.3 bits (64), Expect = 9.3
Identities = 15/44 (34%), Positives = 27/44 (61%)
Frame = +2

Query: 287 TETNM*INKSNKSFIGRFLEKSFKTLNFILKFATITLHYLCMQI 418
TE+ + +NK N++ + +FL FK+L+ IL + +Y CM +
Sbjct: 600 TESILKLNKFNQNGLNQFLH-DFKSLSSILSLPSHATNYKCMSL 642


>sp|Q7U6V9|SYFB_SYNPX Phenylalanyl-tRNA synthetase beta chain
OS=Synechococcus sp. (strain WH8102) GN=pheT PE=3 SV=1
Length = 814

Score = 29.3 bits (64), Expect = 9.3
Identities = 19/63 (30%), Positives = 29/63 (46%)
Frame = -2

Query: 253 SSSTGIRSLYGRVWLLVGATRLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREE 74
S ++G+ + GR+WL S ++ PAA RSV L + AR E + +E
Sbjct: 334 SKASGVTAATGRIWL-----------ESAMFSPAAVRTTARSVGLRTDASARFEKGLPKE 382

Query: 73 NDL 65
L
Sbjct: 383 MTL 385


>sp|Q4ZNY7|MRAY_PSEU2
Phospho-N-acetylmuramoyl-pentapeptide-transferase
OS=Pseudomonas syringae pv. syringae (strain B728a)
GN=mraY PE=3 SV=1
Length = 360

Score = 29.3 bits (64), Expect = 9.3
Identities = 18/61 (29%), Positives = 27/61 (44%)
Frame = +2

Query: 59 YN*IIFFSYLQLKSCLGVLFQ*NRTYNCILGSWIVHSTWKDQV*TGSPNK*PYSSIKRAN 238
Y F YL L+ LGVL T + LG W++ + Q+ N P S + ++
Sbjct: 13 YKGFAVFQYLSLRGILGVLTA--LTLSLCLGPWMIRTLQMRQIGQSVRNDGPQSHLSKSG 70

Query: 239 T 241
T
Sbjct: 71 T 71


>sp|Q87WY2|MRAY_PSESM
Phospho-N-acetylmuramoyl-pentapeptide-transferase
OS=Pseudomonas syringae pv. tomato GN=mraY PE=3 SV=1
Length = 360

Score = 29.3 bits (64), Expect = 9.3
Identities = 18/61 (29%), Positives = 27/61 (44%)
Frame = +2

Query: 59 YN*IIFFSYLQLKSCLGVLFQ*NRTYNCILGSWIVHSTWKDQV*TGSPNK*PYSSIKRAN 238
Y F YL L+ LGVL T + LG W++ + Q+ N P S + ++
Sbjct: 13 YKGFAVFQYLSLRGILGVLTA--LTLSLCLGPWMIRTLQMRQIGQSVRNDGPQSHLSKSG 70

Query: 239 T 241
T
Sbjct: 71 T 71


tr_hit_id A7P6L6
Definition tr|A7P6L6|A7P6L6_VITVI Chromosome chr9 scaffold_7, whole genome shotgun sequence OS=Vitis vinifera
Align length 120
Score (bit) 57.8
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920794|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_F11.
(473 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P6L6|A7P6L6_VITVI Chromosome chr9 scaffold_7, whole genome ... 58 3e-07
tr|Q109L5|Q109L5_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 42 0.015
tr|B8BH91|B8BH91_ORYSI Putative uncharacterized protein OS=Oryza... 42 0.015
tr|A3C5E9|A3C5E9_ORYSJ Putative uncharacterized protein OS=Oryza... 42 0.015
tr|Q9ZW94|Q9ZW94_ARATH F5A8.4 protein OS=Arabidopsis thaliana GN... 39 0.13
tr|Q0D7E4|Q0D7E4_ORYSJ Os07g0258400 protein OS=Oryza sativa subs... 38 0.29
tr|Q1W6C2|Q1W6C2_ORYSJ Metal transporter OS=Oryza sativa subsp. ... 37 0.49
tr|Q8GTY9|Q8GTY9_ORYSJ Nramp1 protein(Natural-resistance-associa... 37 0.64
tr|A2YK11|A2YK11_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.64
tr|A8IFY3|A8IFY3_CHLRE Predicted protein OS=Chlamydomonas reinha... 36 0.84
tr|B6NUJ0|B6NUJ0_BRAFL Putative uncharacterized protein OS=Branc... 36 1.1
tr|B5RU18|B5RU18_DEBHA DEHA2E15620p OS=Debaryomyces hansenii GN=... 35 1.9
tr|A4U1E1|A4U1E1_9PROT Cys/Met metabolism pyridoxal-phosphate-de... 33 5.4
tr|A8NRC2|A8NRC2_COPC7 Putative uncharacterized protein OS=Copri... 33 5.4
tr|Q4CYS5|Q4CYS5_TRYCR Trans-sialidase, putative OS=Trypanosoma ... 33 7.1
tr|Q4PCS7|Q4PCS7_USTMA Putative uncharacterized protein OS=Ustil... 33 7.1
tr|A7HKQ3|A7HKQ3_FERNB NADH:ubiquinone oxidoreductase, subunit D... 33 9.3
tr|B6P4Y2|B6P4Y2_BRAFL Putative uncharacterized protein OS=Branc... 33 9.3
tr|Q4P4T5|Q4P4T5_USTMA Putative uncharacterized protein OS=Ustil... 33 9.3

>tr|A7P6L6|A7P6L6_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034118001
PE=4 SV=1
Length = 2829

Score = 57.8 bits (138), Expect = 3e-07
Identities = 43/120 (35%), Positives = 59/120 (49%), Gaps = 1/120 (0%)
Frame = -2

Query: 376 EDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESSSTGIRSLYGRVWLLVGA 197
++ I+ L + + S+ R I S + L LY Q SST G W +G
Sbjct: 592 QENIKVLSSLIASSNHHRLTASIPSFIEPVLRELYLQC----SSTDFLYNLGCAWSRIGG 647

Query: 196 TRLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREENDLIVRGGTTSE-DNQRLK 20
R L+L S DPA KY++ S+L EK S LE +VR+E D +V +T E D QR K
Sbjct: 648 LRFCLLLSSSDLDPAMKYSIKYSLLEEKISSLELETKVRQECDHLVGWFSTREADKQRAK 707


>tr|Q109L5|Q109L5_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os10g31864 PE=4 SV=1
Length = 5157

Score = 42.0 bits (97), Expect = 0.015
Identities = 42/155 (27%), Positives = 71/155 (45%)
Frame = -2

Query: 466 KTFIRDDAAQIHSLLGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLC 287
K F +++ +++ S+L Q + ++++ A L +SS + SH +
Sbjct: 2918 KHFKQEEYSKLESIL------FQQSEHRVKKEDLDTACALLSRSSHGVLASLAGSHELIG 2971

Query: 286 LDWLYCQSGRESSSTGIRSLYGRVWLLVGATRLNLVLPSRVYDPAAKYAVVRSVLLEKHS 107
L S S G G W+ +G R L+L S DPA + A + S +LEK S
Sbjct: 2972 SLLLELHS---PFSQGYLMHLGAAWVYIGELRFRLLLSSYNPDPAFESAFMHSHILEKIS 3028

Query: 106 EARLELQVREENDLIVRGGTTSEDNQRLKINIQEL 2
LE +VR + + + G ++ ED K+ +QEL
Sbjct: 3029 LLELEGKVRHQCEELA-GSSSEEDGYDQKL-LQEL 3061


>tr|B8BH91|B8BH91_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_33882 PE=4 SV=1
Length = 5024

Score = 42.0 bits (97), Expect = 0.015
Identities = 42/155 (27%), Positives = 71/155 (45%)
Frame = -2

Query: 466 KTFIRDDAAQIHSLLGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLC 287
K F +++ +++ S+L Q + ++++ A L +SS + SH +
Sbjct: 2792 KHFKQEEYSKLESIL------FQQSEHRVKKEDLDTACALLSRSSHGVLASLAGSHELIG 2845

Query: 286 LDWLYCQSGRESSSTGIRSLYGRVWLLVGATRLNLVLPSRVYDPAAKYAVVRSVLLEKHS 107
L S S G G W+ +G R L+L S DPA + A + S +LEK S
Sbjct: 2846 SLLLELHS---PFSQGYLMHLGAAWVYIGELRFRLLLSSYNPDPAFESAFMHSHILEKIS 2902

Query: 106 EARLELQVREENDLIVRGGTTSEDNQRLKINIQEL 2
LE +VR + + + G ++ ED K+ +QEL
Sbjct: 2903 LLELEGKVRHQCEELA-GSSSEEDGYDQKL-LQEL 2935


>tr|A3C5E9|A3C5E9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030521 PE=4 SV=1
Length = 5100

Score = 42.0 bits (97), Expect = 0.015
Identities = 42/155 (27%), Positives = 71/155 (45%)
Frame = -2

Query: 466 KTFIRDDAAQIHSLLGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLC 287
K F +++ +++ S+L Q + ++++ A L +SS + SH +
Sbjct: 2879 KHFKQEEYSKLESIL------FQQSEHRVKKEDLDTACALLSRSSHGVLASLAGSHELIG 2932

Query: 286 LDWLYCQSGRESSSTGIRSLYGRVWLLVGATRLNLVLPSRVYDPAAKYAVVRSVLLEKHS 107
L S S G G W+ +G R L+L S DPA + A + S +LEK S
Sbjct: 2933 SLLLELHS---PFSQGYLMHLGAAWVYIGELRFRLLLSSYNPDPAFESAFMHSHILEKIS 2989

Query: 106 EARLELQVREENDLIVRGGTTSEDNQRLKINIQEL 2
LE +VR + + + G ++ ED K+ +QEL
Sbjct: 2990 LLELEGKVRHQCEELA-GSSSEEDGYDQKL-LQEL 3022


>tr|Q9ZW94|Q9ZW94_ARATH F5A8.4 protein OS=Arabidopsis thaliana
GN=F5A8.4 PE=4 SV=1
Length = 5138

Score = 38.9 bits (89), Expect = 0.13
Identities = 32/100 (32%), Positives = 42/100 (42%)
Frame = -2

Query: 373 DEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESSSTGIRSLYGRVWLLVGAT 194
D IQ L + + SS + + S V LY +SSS G WL +G
Sbjct: 2915 DGIQNLISLIGSSSHNKLKSVTHSFVGPLAKRLYS----DSSSNEFYCNLGLAWLYLGGL 2970

Query: 193 RLNLVLPSRVYDPAAKYAVVRSVLLEKHSEARLELQVREE 74
R +L+ V DPA K L EK S L ++VR E
Sbjct: 2971 RFHLLNSLDVIDPAMKITCKLLKLEEKISSLELNIKVRGE 3010


>tr|Q0D7E4|Q0D7E4_ORYSJ Os07g0258400 protein OS=Oryza sativa subsp.
japonica GN=Os07g0258400 PE=4 SV=1
Length = 518

Score = 37.7 bits (86), Expect = 0.29
Identities = 22/85 (25%), Positives = 40/85 (47%)
Frame = -2

Query: 424 LGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESSS 245
+G + V GD GK+ D+I+ L K+ + KRF++ I +CL +L +
Sbjct: 1 MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQ 60

Query: 244 TGIRSLYGRVWLLVGATRLNLVLPS 170
G Y +W+++ L++ S
Sbjct: 61 AGANHKYELLWVILIGLIFALIIQS 85


>tr|Q1W6C2|Q1W6C2_ORYSJ Metal transporter OS=Oryza sativa subsp.
japonica GN=Nramp1 PE=2 SV=1
Length = 518

Score = 37.0 bits (84), Expect = 0.49
Identities = 20/74 (27%), Positives = 36/74 (48%)
Frame = -2

Query: 424 LGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESSS 245
+G + V GD GK+ D+I+ L K+ + KRF++ I +CL +L +
Sbjct: 1 MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQ 60

Query: 244 TGIRSLYGRVWLLV 203
G Y +W+++
Sbjct: 61 AGANHKYELLWVIL 74


>tr|Q8GTY9|Q8GTY9_ORYSJ Nramp1 protein(Natural-resistance-associated
macrophage protein 1) OS=Oryza sativa subsp. japonica
GN=OJ1354_H07.109 PE=4 SV=2
Length = 519

Score = 36.6 bits (83), Expect = 0.64
Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
Frame = -2

Query: 424 LGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESS- 248
+G + V GD GK+ D+I+ L K+ + KRF++ I +CL +L + E+
Sbjct: 1 MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNSVETDL 60

Query: 247 STGIRSLYGRVWLLVGATRLNLVLPS 170
G Y +W+++ L++ S
Sbjct: 61 QAGANHKYELLWVILIGLIFALIIQS 86


>tr|A2YK11|A2YK11_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25561 PE=4 SV=1
Length = 518

Score = 36.6 bits (83), Expect = 0.64
Identities = 21/85 (24%), Positives = 40/85 (47%)
Frame = -2

Query: 424 LGYLHTKVVQGDRGKLEDEIQRLKAFLKKSSDKRFVTFIDSHVSLCLDWLYCQSGRESSS 245
+G + V GD GK+ D+I+ L K+ + K+F++ I +CL +L +
Sbjct: 1 MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKKFLSHIGPGFMVCLAYLDPGNMETDLQ 60

Query: 244 TGIRSLYGRVWLLVGATRLNLVLPS 170
G Y +W+++ L++ S
Sbjct: 61 AGANHKYELLWVILIGLIFALIIQS 85


>tr|A8IFY3|A8IFY3_CHLRE Predicted protein OS=Chlamydomonas reinhardtii
GN=CHLREDRAFT_169185 PE=4 SV=1
Length = 2681

Score = 36.2 bits (82), Expect = 0.84
Identities = 17/34 (50%), Positives = 20/34 (58%)
Frame = -2

Query: 232 SLYGRVWLLVGATRLNLVLPSRVYDPAAKYAVVR 131
+L GR W L+G RL LV P DPA KY + R
Sbjct: 1569 ALRGRAWALLGLLRLQLVAPPPGIDPAGKYGLKR 1602