BP920796
Clone id YMU001_000141_G01
Library
Length 257
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000141_G01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGAAAAGATGAAGAAATTCAACGAAGAAACTTTTGCCCGAATTTTGTAGACGCATCCGC
AAGATACTTTGCAGTGGATGGTGGAGTCAGCAATACAAATTGAAAGTGTACACCTCCTTG
TACATAGAATCTAATCTCCGCAGTGGGACGAGAACCACTGAACACGAAAACATCAAATTT
ATGTTATCCCTGCTCGATGGATATGTGGCTATCCAAAGAAAGTTTGGAGTAAGGGAATTC
AAACTGACTCCTGAGAT
■■Homology search results ■■ -
sp_hit_id Q8BZ10
Definition sp|Q8BZ10|DESC4_MOUSE Serine protease DESC4 OS=Mus musculus
Align length 37
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920796|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_G01.
(257 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BZ10|DESC4_MOUSE Serine protease DESC4 OS=Mus musculus GN=D... 29 6.3

>sp|Q8BZ10|DESC4_MOUSE Serine protease DESC4 OS=Mus musculus
GN=Desc4 PE=2 SV=1
Length = 417

Score = 29.3 bits (64), Expect = 6.3
Identities = 13/37 (35%), Positives = 19/37 (51%)
Frame = +3

Query: 36 ARIL*THPQDTLQWMVESAIQIESVHLLVHRI*SPQW 146
ARI P D W +S++Q+E +HL + QW
Sbjct: 184 ARIADGKPADKASWPWQSSLQVEGIHLCGASLIGSQW 220


tr_hit_id A4N770
Definition tr|A4N770|A4N770_HAEIN ABC-type Fe3+-hydroxamate transport system, periplasmic component; FhuD OS=Haemophilus influenzae R3021
Align length 47
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920796|Adiantum capillus-veneris mRNA, clone:
YMU001_000141_G01.
(257 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A4N770|A4N770_HAEIN ABC-type Fe3+-hydroxamate transport syste... 33 5.5

>tr|A4N770|A4N770_HAEIN ABC-type Fe3+-hydroxamate transport system,
periplasmic component; FhuD OS=Haemophilus influenzae
R3021 GN=CGSHi22421_05642 PE=4 SV=1
Length = 294

Score = 33.5 bits (75), Expect = 5.5
Identities = 19/47 (40%), Positives = 23/47 (48%)
Frame = -1

Query: 233 LTPNFLWIATYPSSRDNINLMFSCSVVLVPLRRLDSMYKEVYTFNLY 93
L PN IAT S D++NL+F S L L Y +VY N Y
Sbjct: 75 LQPNLELIATLSHSADDLNLVFINSNFYASLNNLLRPYAQVYNVNFY 121