BP920810
Clone id YMU001_000142_A06
Library
Length 457
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000142_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTGAATCAAAGTTACATTTGTCTGTAATAGTAATACAAAAACCTCAGAAGGATGGAGACC
AAAGACACCGGCCCTGATTTTCTGCGCCACTTTCAGGGCCCAAAGTACATTGATGTTGCA
CACAGGAACGACTACTCTAAGCAACCAGCTACTGGTATCACTTCATCCCCTTTTACCTCT
TGTTGATAAACCCCCTTGAATATAATGGGCTGTACAGAGTGCTCTTCAAAGCTCACCCAT
TCATAAGTAGCAAGTGGGTCAGCCTAACCTTCTTCAGGTGGCTTAAACAAGCTACTAGAG
AACTTAATCAGCATCATCTTTGGTGGATCATCAATCTCGGGTAGTTTACACTTTATTTAC
ACTACTTATGTGGTGGACCTGTACAGGAATCCGAGCATCGAGGGGGCGGCACATGCATGC
CCTTACTCTGGCATTCATCCATGCTTGGTTTCTCTCA
■■Homology search results ■■ -
sp_hit_id Q3AMJ2
Definition sp|Q3AMJ2|PUR5_SYNSC Phosphoribosylformylglycinamidine cyclo-ligase OS=Synechococcus sp. (strain CC9605)
Align length 32
Score (bit) 29.6
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920810|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_A06.
(457 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3AMJ2|PUR5_SYNSC Phosphoribosylformylglycinamidine cyclo-lig... 30 6.4
sp|Q6UXL0|I20RB_HUMAN Interleukin-20 receptor beta chain OS=Homo... 29 8.4

>sp|Q3AMJ2|PUR5_SYNSC Phosphoribosylformylglycinamidine cyclo-ligase
OS=Synechococcus sp. (strain CC9605) GN=purM PE=3 SV=2
Length = 345

Score = 29.6 bits (65), Expect = 6.4
Identities = 13/32 (40%), Positives = 18/32 (56%)
Frame = +3

Query: 246 SSKWVSLTFFRWLKQATRELNQHHLWWIINLG 341
+S W T FRWL++A + + LW NLG
Sbjct: 267 ASSWTRPTLFRWLQEA-GNIPERDLWHTFNLG 297


>sp|Q6UXL0|I20RB_HUMAN Interleukin-20 receptor beta chain OS=Homo
sapiens GN=IL20RB PE=1 SV=1
Length = 311

Score = 29.3 bits (64), Expect = 8.4
Identities = 12/25 (48%), Positives = 16/25 (64%)
Frame = +3

Query: 195 LEYNGLYRVLFKAHPFISSKWVSLT 269
+EY G Y L+ +H +I S W SLT
Sbjct: 68 VEYQGEYESLYTSHIWIPSSWCSLT 92


tr_hit_id Q4K8D6
Definition tr|Q4K8D6|Q4K8D6_PSEF5 Acyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)
Align length 35
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920810|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_A06.
(457 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4K8D6|Q4K8D6_PSEF5 Acyltransferase OS=Pseudomonas fluorescen... 34 4.1
tr|A7XI82|A7XI82_9SAUR NADH-ubiquinone oxidoreductase chain 2 (F... 33 5.4
tr|Q3KFP8|Q3KFP8_PSEPF Phospholipid/glycerol acyltransferase OS=... 33 9.2
tr|Q8TWY6|Q8TWY6_METKA Fe-S oxidoreductase OS=Methanopyrus kandl... 33 9.3

>tr|Q4K8D6|Q4K8D6_PSEF5 Acyltransferase OS=Pseudomonas fluorescens
(strain Pf-5 / ATCC BAA-477) GN=PFL_4409 PE=4 SV=1
Length = 624

Score = 33.9 bits (76), Expect = 4.1
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = +2

Query: 350 TLFTLLMWWTCTGIRASRGRHMHALTLAFIHAWFL 454
T+F LL+WW GI S H L F HAW++
Sbjct: 304 TVFGLLLWWHSGGIPESATGHGWIEVLGFAHAWWV 338


>tr|A7XI82|A7XI82_9SAUR NADH-ubiquinone oxidoreductase chain 2
(Fragment) OS=Uroplatus sikorae GN=ND2 PE=3 SV=1
Length = 328

Score = 33.5 bits (75), Expect = 5.4
Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
Frame = +2

Query: 14 TFVCNSNTKTSE-GWRPKTPALIFCATFRAQSTLML 118
T C NT T+E WR KTP ++ TF STLML
Sbjct: 283 TITCPPNTLTTEYKWRFKTPQMLTLTTFSIVSTLML 318


>tr|Q3KFP8|Q3KFP8_PSEPF Phospholipid/glycerol acyltransferase
OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pf01_1665
PE=4 SV=1
Length = 624

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/33 (45%), Positives = 17/33 (51%)
Frame = +2

Query: 350 TLFTLLMWWTCTGIRASRGRHMHALTLAFIHAW 448
T+F LL+WW GI S H L F HAW
Sbjct: 304 TVFGLLLWWHSGGIPESAVGHSWTEVLGFGHAW 336


>tr|Q8TWY6|Q8TWY6_METKA Fe-S oxidoreductase OS=Methanopyrus kandleri
GN=MK0895 PE=4 SV=1
Length = 457

Score = 32.7 bits (73), Expect = 9.3
Identities = 23/68 (33%), Positives = 31/68 (45%)
Frame = -3

Query: 278 PEEG*ADPLATYEWVSFEEHSVQPIIFKGVYQQEVKGDEVIPVAGCLE*SFLCATSMYFG 99
PE+ + PL Y+ V +++S + F VI GC CA+S FG
Sbjct: 162 PEDLDSLPLPAYDKVDLDQYSADSVRFV----------PVITSRGCPFRCLFCASSRIFG 211

Query: 98 P*KWRRKS 75
P KWR KS
Sbjct: 212 P-KWRGKS 218