BP920818
Clone id YMU001_000142_B03
Library
Length 327
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000142_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTGCTGTAGCTAGCACAGGTGCAAGATGCGTATGTGTATGGAATTTGAACCCTTCTTGC
ACATTTCTATCCAAATGAATAGCCAATGTTGGAATTCTCAAGATTGGATCGCCAATTTTG
ACCAACTCGTGTGAGAAAGACATGCTTTCTCCACTTCCTCGCTTCAGAATCACTCTGCCA
GCAATAGTCAAGTCTCTATCAAACCAGGTATGCCACAAACCAGAACCATACGTCTGCACT
CCAACCTCTAAAAAGCCCCCTTTATTTACTTGTGAAACTGGCTTCAATTTAGGACAAGGG
CTATCAGTATGGGCTCCCACTATCATG
■■Homology search results ■■ -
sp_hit_id Q54M70
Definition sp|Q54M70|DNPEP_DICDI Aspartyl aminopeptidase OS=Dictyostelium discoideum
Align length 107
Score (bit) 131.0
E-value 1.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920818|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_B03.
(327 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54M70|DNPEP_DICDI Aspartyl aminopeptidase OS=Dictyostelium d... 131 1e-30
sp|Q9ULA0|DNPEP_HUMAN Aspartyl aminopeptidase OS=Homo sapiens GN... 122 7e-28
sp|Q5RBT2|DNPEP_PONAB Aspartyl aminopeptidase OS=Pongo abelii GN... 121 1e-27
sp|Q9Z2W0|DNPEP_MOUSE Aspartyl aminopeptidase OS=Mus musculus GN... 120 2e-27
sp|Q2HJH1|DNPEP_BOVIN Aspartyl aminopeptidase OS=Bos taurus GN=D... 118 8e-27
sp|O36014|DNPEP_SCHPO Putative aspartyl aminopeptidase OS=Schizo... 111 1e-24
sp|P38821|DNPEP_YEAST Putative aspartyl aminopeptidase OS=Saccha... 110 2e-24
sp|Q19087|DNPEP_CAEEL Putative aspartyl aminopeptidase OS=Caenor... 108 1e-23
sp|Q1IDE6|APEB_PSEE4 Probable M18-family aminopeptidase 2 OS=Pse... 100 3e-21
sp|Q3KFM3|APEB_PSEPF Probable M18-family aminopeptidase 2 OS=Pse... 97 2e-20
sp|B0KTU0|APEB_PSEPG Probable M18-family aminopeptidase 2 OS=Pse... 97 3e-20
sp|A5W7K3|APEB_PSEP1 Probable M18-family aminopeptidase 2 OS=Pse... 97 3e-20
sp|Q88M44|APEB_PSEPK Probable M18 family aminopeptidase 2 OS=Pse... 97 3e-20
sp|Q4ZW15|APEB_PSEU2 Probable M18-family aminopeptidase 2 OS=Pse... 96 7e-20
sp|Q48L80|APEB_PSE14 Probable M18-family aminopeptidase 2 OS=Pse... 96 7e-20
sp|Q87YC5|APEB_PSESM Probable M18 family aminopeptidase 2 OS=Pse... 95 1e-19
sp|A4VJG1|APEB_PSEU5 Probable M18-family aminopeptidase 2 OS=Pse... 94 2e-19
sp|Q9HYZ3|APEB_PSEAE Probable M18 family aminopeptidase 2 OS=Pse... 94 2e-19
sp|Q02Q78|APEB_PSEAB Probable M18-family aminopeptidase 2 OS=Pse... 94 2e-19
sp|A6V2H4|APEB_PSEA7 Probable M18-family aminopeptidase 2 OS=Pse... 94 2e-19
sp|A4XRN0|APEB_PSEMY Probable M18-family aminopeptidase 2 OS=Pse... 94 3e-19
sp|Q9XA76|APEB_STRCO Probable M18 family aminopeptidase 2 OS=Str... 90 3e-18
sp|Q82F74|APEB_STRAW Probable M18 family aminopeptidase 2 OS=Str... 87 3e-17
sp|A0PYH7|APEB_CLONN Probable M18-family aminopeptidase 2 OS=Clo... 84 2e-16
sp|Q97LF4|APEB_CLOAB Probable M18 family aminopeptidase 2 OS=Clo... 82 6e-16
sp|A1KGT3|APEB_MYCBP Probable M18-family aminopeptidase 2 OS=Myc... 78 1e-14
sp|P59951|APEB_MYCBO Probable M18 family aminopeptidase 2 OS=Myc... 78 1e-14
sp|O06634|APEB_MYCTU Probable M18 family aminopeptidase 2 OS=Myc... 77 4e-14
sp|A5U0I9|APEB_MYCTA Probable M18-family aminopeptidase 2 OS=Myc... 77 4e-14
sp|Q50022|APEB_MYCLE Probable M18 family aminopeptidase 2 OS=Myc... 74 2e-13

>sp|Q54M70|DNPEP_DICDI Aspartyl aminopeptidase OS=Dictyostelium
discoideum GN=dnpep PE=3 SV=1
Length = 484

Score = 131 bits (329), Expect = 1e-30
Identities = 64/107 (59%), Positives = 83/107 (77%), Gaps = 1/107 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I AHTDSP K++PVS+V G+ +VGV+TYG GLW+TWFDRDLT+AGRVI+K G G
Sbjct: 80 IAAAHTDSPNFKVRPVSKVESVGYQQVGVETYGGGLWYTWFDRDLTVAGRVIVKSGDG-- 137

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLAT 6
S+ +LV I PILRIP+LAIHLDR+V +GFK++T HL P++A+
Sbjct: 138 -SYESKLVHIKKPILRIPSLAIHLDRSVNTDGFKYNTQNHLVPMIAS 183


>sp|Q9ULA0|DNPEP_HUMAN Aspartyl aminopeptidase OS=Homo sapiens
GN=DNPEP PE=1 SV=1
Length = 475

Score = 122 bits (305), Expect = 7e-28
Identities = 60/107 (56%), Positives = 77/107 (71%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
++GAHTDSPC ++K S+ ++ GF +VGV+TYG G+W TWFDRDLT+AGRVI+K S
Sbjct: 90 LIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK--CPTS 147

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLATA 3
+LV + PILRIP LAIHL RN+ E F +T HL P+LATA
Sbjct: 148 GRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATA 194


>sp|Q5RBT2|DNPEP_PONAB Aspartyl aminopeptidase OS=Pongo abelii
GN=DNPEP PE=2 SV=1
Length = 471

Score = 121 bits (303), Expect = 1e-27
Identities = 60/107 (56%), Positives = 76/107 (71%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
++GAHTDSPC ++K S+ ++ GF +VGV+TYG G+W TWFDRDLT+AGRVI+K S
Sbjct: 86 LIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK--CPTS 143

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLATA 3
LV + PILRIP LAIHL RN+ E F +T HL P+LATA
Sbjct: 144 GRLEQRLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATA 190


>sp|Q9Z2W0|DNPEP_MOUSE Aspartyl aminopeptidase OS=Mus musculus
GN=Dnpep PE=2 SV=1
Length = 473

Score = 120 bits (302), Expect = 2e-27
Identities = 60/107 (56%), Positives = 76/107 (71%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
++GAHTDSPC ++K S+ ++ G+ +VGV+TYG G+W TWFDRDLT+AGRVI+K S
Sbjct: 88 LIGAHTDSPCLRVKRKSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGRVIIK--CPTS 145

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLATA 3
LV I PILRIP LAIHL RN+ E F +T HL P+LATA
Sbjct: 146 GRLEQRLVHIERPILRIPHLAIHLQRNINENFGPNTEIHLVPILATA 192


>sp|Q2HJH1|DNPEP_BOVIN Aspartyl aminopeptidase OS=Bos taurus
GN=DNPEP PE=2 SV=1
Length = 471

Score = 118 bits (296), Expect = 8e-27
Identities = 59/107 (55%), Positives = 75/107 (70%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
++GAHTDSPC ++K S+ ++ GF +VGV+TYG G+W TWFDRDLT+AGRVI+K S
Sbjct: 86 LIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVK--CPTS 143

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLATA 3
LV + PILRIP LAIHL RNV E F + HL P+LAT+
Sbjct: 144 GRLEQRLVHVDRPILRIPHLAIHLQRNVNENFGPNMEMHLVPILATS 190


>sp|O36014|DNPEP_SCHPO Putative aspartyl aminopeptidase
OS=Schizosaccharomyces pombe GN=SPAC4F10.02 PE=2 SV=1
Length = 467

Score = 111 bits (278), Expect = 1e-24
Identities = 51/104 (49%), Positives = 71/104 (68%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I+ HTDSP +LKP SQ + G+L+VGV+ YG G+WHTWFDRDL++AGRV+++ G
Sbjct: 83 IIATHTDSPTLRLKPKSQKSAYGYLQVGVEKYGGGIWHTWFDRDLSLAGRVMVEEEDGRV 142

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVL 12
+ ++ V I P+LRIPTLAIHLD + F F+ T P++
Sbjct: 143 IQYN---VHIDRPLLRIPTLAIHLDPSANSSFSFNMETEFVPLI 183


>sp|P38821|DNPEP_YEAST Putative aspartyl aminopeptidase
OS=Saccharomyces cerevisiae GN=YHR113W PE=1 SV=1
Length = 490

Score = 110 bits (276), Expect = 2e-24
Identities = 52/104 (50%), Positives = 76/104 (73%), Gaps = 1/104 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRG-SGE 147
I GAHTDSP ++KP+S+ +L+VGV+TYG +WH+WFD+DL +AGRV +K +G+
Sbjct: 93 ITGAHTDSPALRIKPISKRVSEKYLQVGVETYGGAIWHSWFDKDLGVAGRVFVKDAKTGK 152

Query: 146 SMSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPV 15
S++ LV + P+L+IPTLAIHLDR+V + F+F+ T L P+
Sbjct: 153 SIA---RLVDLNRPLLKIPTLAIHLDRDVNQKFEFNRETQLLPI 193


>sp|Q19087|DNPEP_CAEEL Putative aspartyl aminopeptidase
OS=Caenorhabditis elegans GN=F01F1.9 PE=2 SV=1
Length = 470

Score = 108 bits (269), Expect = 1e-23
Identities = 53/106 (50%), Positives = 70/106 (66%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
IV HTDSPC ++KP+S FL+VGV TYG G+W TWFDRDL++AG VI+K G
Sbjct: 88 IVVGHTDSPCLRVKPISHQKSDKFLQVGVSTYGGGIWRTWFDRDLSVAGLVIVKNGE--- 144

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLAT 6
H+L+ + P+L IP LAIHL+ + + FK +T T L P+L T
Sbjct: 145 -KLQHKLIDVKKPVLFIPNLAIHLETD-RTTFKPNTETELRPILET 188


>sp|Q1IDE6|APEB_PSEE4 Probable M18-family aminopeptidase 2
OS=Pseudomonas entomophila (strain L48) GN=apeB PE=3
SV=1
Length = 429

Score = 100 bits (248), Expect = 3e-21
Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 1/106 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKR-GSGE 147
+VGAHTDSPC ++KP ++ + GFL++GV+ YG L WFDRDL++AGRV +R G E
Sbjct: 78 MVGAHTDSPCLRVKPQPELQRQGFLQLGVEVYGGALLAPWFDRDLSLAGRVTFRRDGKVE 137

Query: 146 SMSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLA 9
S +L+ PI IP LAIHL+R EG++ + T L P+LA
Sbjct: 138 S-----QLIDFKLPIAVIPNLAIHLNRTANEGWQINPQTELPPILA 178


>sp|Q3KFM3|APEB_PSEPF Probable M18-family aminopeptidase 2
OS=Pseudomonas fluorescens (strain Pf0-1) GN=apeB PE=3
SV=1
Length = 429

Score = 97.4 bits (241), Expect = 2e-20
Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 1/106 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKR-GSGE 147
+VGAHTDSPC ++KP ++ + GF ++GV+ YG L WFDRDL++AGRV +R G E
Sbjct: 78 LVGAHTDSPCLRVKPQPELQRQGFWQLGVEVYGGALLAPWFDRDLSLAGRVTFRRDGKVE 137

Query: 146 SMSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLA 9
S +L+ PI IP LAIHL+R +G+ + T L P+LA
Sbjct: 138 S-----QLIDFKAPIAIIPNLAIHLNREANQGWAINAQTELPPILA 178


tr_hit_id A9RRM1
Definition tr|A9RRM1|A9RRM1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 103
Score (bit) 171.0
E-value 2.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920818|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_B03.
(327 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RRM1|A9RRM1_PHYPA Predicted protein OS=Physcomitrella paten... 171 2e-41
tr|Q9LST0|Q9LST0_ARATH Aspartyl aminopeptidase (At5g60160/f15l12... 169 8e-41
tr|Q8LF32|Q8LF32_ARATH Aspartyl aminopeptidase-like protein OS=A... 169 8e-41
tr|A7PHE3|A7PHE3_VITVI Chromosome chr17 scaffold_16, whole genom... 164 2e-39
tr|B8LN23|B8LN23_PICSI Putative uncharacterized protein OS=Picea... 160 4e-38
tr|Q2QVB4|Q2QVB4_ORYSJ Os12g0236500 protein OS=Oryza sativa subs... 154 2e-36
tr|Q00XS8|Q00XS8_OSTTA Aspartyl aminopeptidase (ISS) OS=Ostreoco... 154 2e-36
tr|A2ZJA7|A2ZJA7_ORYSI Putative uncharacterized protein OS=Oryza... 154 2e-36
tr|A4S5U4|A4S5U4_OSTLU Predicted protein OS=Ostreococcus lucimar... 153 4e-36
tr|A9RD26|A9RD26_PHYPA Predicted protein (Fragment) OS=Physcomit... 147 3e-34
tr|A7QLJ4|A7QLJ4_VITVI Chromosome undetermined scaffold_119, who... 141 1e-32
tr|Q8SA06|Q8SA06_ORYSJ Putative aspartyl aminopeptidase (Os01g09... 137 3e-31
tr|B8A9V6|B8A9V6_ORYSI Putative uncharacterized protein OS=Oryza... 137 3e-31
tr|Q9LZ26|Q9LZ26_ARATH Aspartyl aminopeptidase-like protein OS=A... 132 7e-30
tr|Q8GWI9|Q8GWI9_ARATH Putative aspartyl aminopeptidase OS=Arabi... 132 7e-30
tr|A4S7N7|A4S7N7_OSTLU Predicted protein OS=Ostreococcus lucimar... 130 4e-29
tr|Q00V22|Q00V22_OSTTA Aspartyl aminopeptidase (ISS) (Fragment) ... 129 7e-29
tr|B2KIA3|B2KIA3_RHIFE Aspartyl aminopeptidase (Predicted) OS=Rh... 125 8e-28
tr|Q0V7C1|Q0V7C1_PHANO Putative uncharacterized protein OS=Phaeo... 125 8e-28
tr|A6R3T9|A6R3T9_AJECN Putative uncharacterized protein OS=Ajell... 125 1e-27
tr|A5C4F0|A5C4F0_VITVI Putative uncharacterized protein OS=Vitis... 125 1e-27
tr|A8NX64|A8NX64_COPC7 Putative uncharacterized protein OS=Copri... 125 1e-27
tr|A9T427|A9T427_PHYPA Predicted protein OS=Physcomitrella paten... 124 2e-27
tr|B0CY23|B0CY23_LACBS Aspartyl aminopeptidase OS=Laccaria bicol... 124 2e-27
tr|A1CJU9|A1CJU9_ASPCL Aspartyl aminopeptidase OS=Aspergillus cl... 124 3e-27
tr|B5X1S2|B5X1S2_SALSA Aspartyl aminopeptidase OS=Salmo salar GN... 123 5e-27
tr|B2WB98|B2WB98_PYRTR Aspartyl aminopeptidase OS=Pyrenophora tr... 122 7e-27
tr|A9UYA6|A9UYA6_MONBE Predicted protein OS=Monosiga brevicollis... 122 1e-26
tr|Q9NV55|Q9NV55_HUMAN cDNA FLJ10915 fis, clone OVARC1000288, we... 122 1e-26
tr|Q9HAC6|Q9HAC6_HUMAN cDNA FLJ11809 fis, clone HEMBA1006309, hi... 122 1e-26

>tr|A9RRM1|A9RRM1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_118420 PE=3 SV=1
Length = 467

Score = 171 bits (432), Expect = 2e-41
Identities = 76/103 (73%), Positives = 89/103 (86%)
Frame = -2

Query: 326 MIVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGE 147
+I+GAHTDSPCPKLKP ++V K GFLEVGV TYG GLWHTWFDRDLT+AGRV+LKR +GE
Sbjct: 80 LIIGAHTDSPCPKLKPTTKVIKSGFLEVGVSTYGGGLWHTWFDRDLTVAGRVVLKRKNGE 139

Query: 146 SMSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAP 18
S+SHELV++ PI+RIPTLAIHLDR V +GFK +T THLAP
Sbjct: 140 KSSYSHELVRVEQPIMRIPTLAIHLDRGVNDGFKVNTQTHLAP 182


>tr|Q9LST0|Q9LST0_ARATH Aspartyl aminopeptidase
(At5g60160/f15l12_20) OS=Arabidopsis thaliana
GN=At5g60160 PE=2 SV=1
Length = 477

Score = 169 bits (427), Expect = 8e-41
Identities = 82/108 (75%), Positives = 92/108 (85%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I+GAHTDSPC KLKPVS++ KGG LEVGVQTYG GLW+TWFDRDLT+AGRVILK S
Sbjct: 79 IIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTVAGRVILKEEKAGS 138

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLATA 3
+S+SH LV+I DPI+RIPTLAIHLDRNV EGFK +T THL PVLATA
Sbjct: 139 VSYSHRLVRIEDPIMRIPTLAIHLDRNVNTEGFKPNTQTHLVPVLATA 186


>tr|Q8LF32|Q8LF32_ARATH Aspartyl aminopeptidase-like protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 477

Score = 169 bits (427), Expect = 8e-41
Identities = 82/108 (75%), Positives = 92/108 (85%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I+GAHTDSPC KLKPVS++ KGG LEVGVQTYG GLW+TWFDRDLT+AGRVILK S
Sbjct: 79 IIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTVAGRVILKEEKAGS 138

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLATA 3
+S+SH LV+I DPI+RIPTLAIHLDRNV EGFK +T THL PVLATA
Sbjct: 139 VSYSHRLVRIEDPIMRIPTLAIHLDRNVNTEGFKPNTQTHLVPVLATA 186


>tr|A7PHE3|A7PHE3_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017908001
PE=3 SV=1
Length = 474

Score = 164 bits (416), Expect = 2e-39
Identities = 75/106 (70%), Positives = 90/106 (84%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
IVGAHTDSPC KLKP+S+V KGG+LEVGVQTYG GLWHTWFDRDLT+AGRVI++ G
Sbjct: 86 IVGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTVAGRVIIREGKD-- 143

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLAT 6
+FSH+LV+I +PI+RIP LAIHLDR V +GFK + H+HL P+LAT
Sbjct: 144 -AFSHKLVRIEEPIMRIPNLAIHLDRGVNDGFKVNAHSHLVPILAT 188


>tr|B8LN23|B8LN23_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 502

Score = 160 bits (404), Expect = 4e-38
Identities = 76/107 (71%), Positives = 87/107 (81%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
IV AHTDSPC KLKP S+V KGGFLE+GVQ YG GLWHTWFDRDLT+AGRV++KR +
Sbjct: 85 IVCAHTDSPCLKLKPSSKVTKGGFLEIGVQPYGGGLWHTWFDRDLTVAGRVMVKRNVDGA 144

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQEGFKFHTHTHLAPVLATA 3
+S++HELV I +PILRIPTLAIHLDR V +GFK HL PVLATA
Sbjct: 145 VSYTHELVTIQEPILRIPTLAIHLDRAVNDGFKVDKQAHLVPVLATA 191


>tr|Q2QVB4|Q2QVB4_ORYSJ Os12g0236500 protein OS=Oryza sativa subsp.
japonica GN=Os12g0236500 PE=3 SV=1
Length = 478

Score = 154 bits (389), Expect = 2e-36
Identities = 70/108 (64%), Positives = 90/108 (83%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I+GAHTDSP KLKPVS+V KGG+LEVGVQTYG GLW+TWFDRDLT+AGRVI++ +
Sbjct: 85 IIGAHTDSPSLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLTVAGRVIVREKKDGA 144

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNV-QEGFKFHTHTHLAPVLATA 3
+S++H+LV++ +P++RIPTLAIHLDRN+ EG K + HL PVLAT+
Sbjct: 145 VSYAHKLVRVQEPVMRIPTLAIHLDRNISSEGLKINNQNHLVPVLATS 192


>tr|Q00XS8|Q00XS8_OSTTA Aspartyl aminopeptidase (ISS)
OS=Ostreococcus tauri GN=Ot12g02310 PE=3 SV=1
Length = 486

Score = 154 bits (389), Expect = 2e-36
Identities = 70/108 (64%), Positives = 89/108 (82%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
++ AHTDSPCPKLKPV+++ KGGF++VGVQTYG GLWHTWFDRDL++AGRV+++RG
Sbjct: 104 VIAAHTDSPCPKLKPVTKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAGRVLVRRGE--- 160

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLATA 3
SHELV++ PI+RIPTLAIHLDR + GFK +T T+ AP+LATA
Sbjct: 161 -KLSHELVRVDRPIIRIPTLAIHLDREISTNGFKPNTETNFAPILATA 207


>tr|A2ZJA7|A2ZJA7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37907 PE=3 SV=1
Length = 478

Score = 154 bits (389), Expect = 2e-36
Identities = 70/108 (64%), Positives = 90/108 (83%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
I+GAHTDSP KLKPVS+V KGG+LEVGVQTYG GLW+TWFDRDLT+AGRVI++ +
Sbjct: 85 IIGAHTDSPSLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLTVAGRVIVREKKDGA 144

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNV-QEGFKFHTHTHLAPVLATA 3
+S++H+LV++ +P++RIPTLAIHLDRN+ EG K + HL PVLAT+
Sbjct: 145 VSYAHKLVRVQEPVMRIPTLAIHLDRNISSEGLKINNQNHLVPVLATS 192


>tr|A4S5U4|A4S5U4_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_13136 PE=3 SV=1
Length = 465

Score = 153 bits (387), Expect = 4e-36
Identities = 72/108 (66%), Positives = 88/108 (81%), Gaps = 1/108 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
+V AHTDSPCPKLKPVS++ KGGF++VGVQTYG GLWHTWFDRDL++AGRV++KR
Sbjct: 80 VVAAHTDSPCPKLKPVSKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAGRVLVKRDG--- 136

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLATA 3
+HELV+I PI+RIPTLAIHLDR + GFK +T T+ AP+LATA
Sbjct: 137 -KLAHELVRIDRPIIRIPTLAIHLDREISTNGFKPNTETNFAPILATA 183


>tr|A9RD26|A9RD26_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_111408 PE=3 SV=1
Length = 471

Score = 147 bits (371), Expect = 3e-34
Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 1/107 (0%)
Frame = -2

Query: 323 IVGAHTDSPCPKLKPVSQVNKGGFLEVGVQTYGSGLWHTWFDRDLTIAGRVILKRGSGES 144
IV AHTDSPCPKLKPVS +K GFL VGVQTYG GLWHTWFDRDL++AGRV+L++ +G
Sbjct: 75 IVAAHTDSPCPKLKPVSAASKAGFLNVGVQTYGGGLWHTWFDRDLSVAGRVLLRKKNG-- 132

Query: 143 MSFSHELVKIGDPILRIPTLAIHLDRNVQ-EGFKFHTHTHLAPVLAT 6
+ L+K+ PI+RIPTLAIHLDR V +GFK + THLAPVLAT
Sbjct: 133 -TIVQGLIKVDRPIMRIPTLAIHLDRTVNTDGFKPNLETHLAPVLAT 178