BP920846
Clone id YMU001_000142_D09
Library
Length 384
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000142_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTTCTAGCATGGGTTCATCAATCTCCAAGAATACAGATCCCTGCTCTAAAGCACAAGTC
ATGCTCACAAATCCGTTCAATCACTGCACACACATCAACATATGGCTTCAAAACAGGATC
CACATCCAACAAATCCACAACATGGCTCTCAACCTTGCCCTCTTCCCTTATGTCCAAGGA
ACTAGTATCCAAAGATACGTGCTCATTATCAATAAGCTCAACCTCACACTCACACCCAAA
ATCACAAGGTACATAAGTAGCCAATGCATCCTCTTCAAGACTTTGCAATCCTGTATCCAA
AGCATTACTCACCTCTTTAGGCTCTTCCATAAATCTGTCAACCTGCAAGACCTCTTTACG
CTTCACAATAGACCTTGGGAAGAA
■■Homology search results ■■ -
sp_hit_id Q8K1L0
Definition sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5 OS=Mus musculus
Align length 72
Score (bit) 33.9
E-value 0.25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920846|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_D09.
(384 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5 ... 34 0.25
sp|Q02930|CREB5_HUMAN cAMP-responsive element-binding protein 5 ... 33 0.57
sp|P38898|YH17_YEAST Putative uncharacterized protein YHR217C OS... 32 1.3
sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens GN... 32 1.3
sp|P12977|EBNA3_EBV Epstein-Barr nuclear antigen 3 OS=Epstein-Ba... 31 1.7
sp|Q94AV5|WIP3_ARATH WPP domain-interacting protein 3 OS=Arabido... 31 2.2
sp|Q9BVV6|K0586_HUMAN Uncharacterized protein KIAA0586 OS=Homo s... 31 2.2
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase r... 30 2.9
sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein DDB... 30 3.7
sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus GN... 30 3.7
sp|P43651|AFLR_ASPPA Aflatoxin biosynthesis regulatory protein O... 30 3.7
sp|P41765|AFLR_ASPFL Aflatoxin biosynthesis regulatory protein O... 30 3.7
sp|Q8I913|SMD13_LOXLA Sphingomyelin phosphodiesterase D OS=Loxos... 30 3.8
sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallu... 30 3.8
sp|Q07021|C1QBP_HUMAN Complement component 1 Q subcomponent-bind... 30 4.9
sp|P22807|SLOU_DROME Homeobox protein slou OS=Drosophila melanog... 29 6.3
sp|Q6IRN0|S11IP_XENLA Serine/threonine kinase 11-interacting pro... 29 6.3
sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens GN... 29 6.3
sp|Q9Y725|MPG11_CANGA Mannose-1-phosphate guanyltransferase 1 OS... 29 6.5
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Ory... 29 8.2
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Sch... 29 8.2
sp|P06719|KNOB_PLAFN Knob-associated histidine-rich protein OS=P... 29 8.2
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein co... 29 8.4
sp|O74898|DPH5_SCHPO Diphthine synthase OS=Schizosaccharomyces p... 29 8.4

>sp|Q8K1L0|CREB5_MOUSE cAMP-responsive element-binding protein 5
OS=Mus musculus GN=Creb5 PE=2 SV=3
Length = 357

Score = 33.9 bits (76), Expect = 0.25
Identities = 21/72 (29%), Positives = 28/72 (38%)
Frame = +3

Query: 54 TSHAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHTH 233
T H H LH+H H PH P P +P + H+Q PH H
Sbjct: 118 TPHHH-----LHSHPHQHQTLPPHHPYPHQHQHPAH--------HPHPQPHHQQNHPHHH 164

Query: 234 TQNHKVHK*PMH 269
+ +H +H P H
Sbjct: 165 SHSH-LHAHPAH 175



Score = 31.6 bits (70), Expect = 1.3
Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 3/77 (3%)
Frame = +3

Query: 87 HTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YP---KIRAHYQ*AQPHTHTQNHKVHK 257
H + M S+QD P + H L P + YP + AH+ QPH H QNH
Sbjct: 106 HMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPH-HQQNH---- 160

Query: 258 *PMHPLQDFAILYPKHY 308
P H +P H+
Sbjct: 161 -PHHHSHSHLHAHPAHH 176


>sp|Q02930|CREB5_HUMAN cAMP-responsive element-binding protein 5
OS=Homo sapiens GN=CREB5 PE=1 SV=2
Length = 508

Score = 32.7 bits (73), Expect = 0.57
Identities = 22/66 (33%), Positives = 28/66 (42%)
Frame = +3

Query: 72 SVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHTHTQNHKV 251
S Q H HM S H T P H P P +P + H+Q PH H+ +H +
Sbjct: 264 SRQDQTPHHHMHSHPHQHQTLPPH--HPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSH-L 320

Query: 252 HK*PMH 269
H P H
Sbjct: 321 HAHPAH 326



Score = 32.3 bits (72), Expect = 0.74
Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 3/77 (3%)
Frame = +3

Query: 87 HTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YP---KIRAHYQ*AQPHTHTQNHKVHK 257
H + M S+QD P + H L P + YP + AH+ QPH H QNH
Sbjct: 257 HMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPH-HQQNH---- 311

Query: 258 *PMHPLQDFAILYPKHY 308
P H +P H+
Sbjct: 312 -PHHHSHSHLHAHPAHH 327


>sp|P38898|YH17_YEAST Putative uncharacterized protein YHR217C
OS=Saccharomyces cerevisiae GN=YHR217C PE=5 SV=1
Length = 153

Score = 31.6 bits (70), Expect = 1.3
Identities = 29/106 (27%), Positives = 36/106 (33%), Gaps = 6/106 (5%)
Frame = +3

Query: 30 EYRSLL*STSHAHKSVQS---LHTHQHMASKQD-PHPTNPQHGSQPCPLPLCPRN*YPKI 197
+Y + T H H HTH H + PHP P + P P P
Sbjct: 13 QYSDIYIHTPHPHPHPHPHTPTHTHPHTPTPTPHPHPHTPHPHTTPTPTP---------- 62

Query: 198 RAHYQ*AQPHTHTQNHKVHK*PMHPLQDFAILYPKHY--SPL*ALP 329
HTHT P L + ++ P HY SPL LP
Sbjct: 63 --------HHTHT--------PHTTLSNLSLNLPSHYPTSPLVTLP 92


>sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens
GN=FOXJ3 PE=1 SV=1
Length = 622

Score = 31.6 bits (70), Expect = 1.3
Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 5/74 (6%)
Frame = +3

Query: 51 STSHAHKSVQSLHTHQHMASKQDPHPTNPQHG----SQPCPLPLCPRN*YPKIRA-HYQ* 215
+T+ ++ Q +H M + PHP + HG Q P P + ++++ H Q
Sbjct: 358 NTTGSNSVAQVSLSHPQMHPQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQH 417

Query: 216 AQPHTHTQNHKVHK 257
PH H Q+H H+
Sbjct: 418 PSPHQHIQHHPNHQ 431


>sp|P12977|EBNA3_EBV Epstein-Barr nuclear antigen 3 OS=Epstein-Barr
virus (strain B95-8) GN=EBNA3 PE=1 SV=1
Length = 812

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/49 (32%), Positives = 24/49 (48%)
Frame = +3

Query: 51 STSHAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKI 197
+TSH V T H+A++ +P + QHG PCP+ P P +
Sbjct: 303 ATSHGSAQVPEPPTI-HLAAQGMAYPLHEQHGMAPCPVAQAPPTPLPPV 350


>sp|Q94AV5|WIP3_ARATH WPP domain-interacting protein 3
OS=Arabidopsis thaliana GN=WIP3 PE=1 SV=1
Length = 459

Score = 30.8 bits (68), Expect = 2.2
Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
Frame = -1

Query: 375 RSIVKRKEVLQVDRFMEEPKEVSNALDTGLQSLEEDALATYVPCDFGCECEVELIDNEHV 196
++++ +++V ++ +EE + A + +Q LE + + + C F + E E+ EH+
Sbjct: 332 KALILKEKVKLLEHKLEEARAALEAKEARIQELENSKIESELECIFQRKIETEI---EHL 388

Query: 195 SL--DTSSLDIREEGK 154
L SSL + +E K
Sbjct: 389 MLTRSLSSLQVLQETK 404


>sp|Q9BVV6|K0586_HUMAN Uncharacterized protein KIAA0586 OS=Homo
sapiens GN=KIAA0586 PE=1 SV=2
Length = 1533

Score = 30.8 bits (68), Expect = 2.2
Identities = 19/54 (35%), Positives = 29/54 (53%)
Frame = -1

Query: 324 EPKEVSNALDTGLQSLEEDALATYVPCDFGCECEVELIDNEHVSLDTSSLDIRE 163
+PK +S DT S+ ED+ A++ P G E+EL N + L T+ L +E
Sbjct: 1362 DPKPLSRQFDTVSGSIYEDSCASHGPMSLG---ELELEPNSKLVLPTTLLTAQE 1412


>sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8
OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1
Length = 1867

Score = 30.4 bits (67), Expect = 2.9
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
Frame = -1

Query: 300 LDTGLQSLEEDALATYVPCDFGCECEVELIDNEHVSLDTSSLDIREE--GKVESH 142
+DT L+ + + TY+PC CEC D H+ +D+ EE GK ESH
Sbjct: 1375 VDTILKDYQINQSQTYIPCSCSCECR----DLPHL----FPIDLIEETFGKGESH 1421


>sp|Q8MP30|Y7791_DICDI Uncharacterized histidine-rich protein
DDB0167791 OS=Dictyostelium discoideum GN=DDB_G0274557
PE=4 SV=1
Length = 233

Score = 30.0 bits (66), Expect = 3.7
Identities = 18/65 (27%), Positives = 21/65 (32%)
Frame = +3

Query: 60 HAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHTHTQ 239
H H H H H H +P H P P P + +P H PH H
Sbjct: 130 HHHHHHHHHHHHHHHHHHHHHHHHHPHHHPHPHPHPHPHPHLHPNPHPH---PHPHPHPH 186

Query: 240 NHKVH 254
H H
Sbjct: 187 PHPHH 191


>sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus
GN=Foxj3 PE=2 SV=1
Length = 623

Score = 30.0 bits (66), Expect = 3.7
Identities = 22/69 (31%), Positives = 24/69 (34%)
Frame = +3

Query: 51 STSHAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHT 230
S SH Q H HP PQH P P P P H Q PH
Sbjct: 370 SLSHPQMHPQPSPHTPHRPHGLPQHPQRPQH---PAPHPQQHSQLQPP---HSQHPPPHQ 423

Query: 231 HTQNHKVHK 257
H Q+H H+
Sbjct: 424 HIQHHPNHQ 432


tr_hit_id Q5K7F1
Definition tr|Q5K7F1|Q5K7F1_CRYNE RNA polymerase II transcription factor, putative OS=Cryptococcus neoformans
Align length 72
Score (bit) 39.3
E-value 0.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920846|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_D09.
(384 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5K7F1|Q5K7F1_CRYNE RNA polymerase II transcription factor, p... 39 0.10
tr|Q55HW7|Q55HW7_CRYNE Putative uncharacterized protein OS=Crypt... 39 0.10
tr|B4LWW7|B4LWW7_DROVI GJ23490 OS=Drosophila virilis GN=GJ23490 ... 37 0.38
tr|B4KJY5|B4KJY5_DROMO GI23919 OS=Drosophila mojavensis GN=GI239... 37 0.50
tr|B3MA92|B3MA92_DROAN GF25137 OS=Drosophila ananassae GN=GF2513... 37 0.50
tr|Q7Q6F2|Q7Q6F2_ANOGA AGAP005880-PA OS=Anopheles gambiae GN=AGA... 37 0.65
tr|B3NTG0|B3NTG0_DROER GG18108 OS=Drosophila erecta GN=GG18108 P... 37 0.65
tr|A9P7G7|A9P7G7_9SAUR Amelogenin (Fragment) OS=Aplopeltura boa ... 36 1.1
tr|Q9VRN4|Q9VRN4_DROME Blimp-1 OS=Drosophila melanogaster GN=Bli... 35 1.4
tr|B6MWK1|B6MWK1_BRAFL Putative uncharacterized protein OS=Branc... 35 1.4
tr|A9P7G5|A9P7G5_9SAUR Amelogenin (Fragment) OS=Stoliczkaia born... 35 1.9
tr|Q4H2U0|Q4H2U0_CIOIN Transcription factor protein OS=Ciona int... 35 1.9
tr|B4F7T6|B4F7T6_MAIZE Putative uncharacterized protein OS=Zea m... 35 2.5
tr|B4IFV7|B4IFV7_DROSE GM14920 OS=Drosophila sechellia GN=GM1492... 35 2.5
tr|B3N7A0|B3N7A0_DROER GG24080 OS=Drosophila erecta GN=GG24080 P... 35 2.5
tr|Q1DPX5|Q1DPX5_COCIM Putative uncharacterized protein OS=Cocci... 35 2.5
tr|B3N8I2|B3N8I2_DROER GG24007 OS=Drosophila erecta GN=GG24007 P... 34 3.2
tr|A5AYP0|A5AYP0_VITVI Putative uncharacterized protein OS=Vitis... 34 3.2
tr|B4JFT5|B4JFT5_DROGR GH18208 OS=Drosophila grimshawi GN=GH1820... 34 3.2
tr|A5EQB4|A5EQB4_BRASB Protoporphyrin IX magnesium-chelatase OS=... 34 4.2
tr|A5HUJ5|A5HUJ5_CHICK Putative uncharacterized protein LOC42772... 34 4.2
tr|Q556J6|Q556J6_DICDI Putative uncharacterized protein (Similar... 34 4.2
tr|Q54XU4|Q54XU4_DICDI Putative uncharacterized protein (Fragmen... 34 4.2
tr|Q2M054|Q2M054_DROPS GA11582 OS=Drosophila pseudoobscura pseud... 34 4.2
tr|Q29EE8|Q29EE8_DROPS GA16633 OS=Drosophila pseudoobscura pseud... 34 4.2
tr|B4MQ40|B4MQ40_DROWI GK21819 OS=Drosophila willistoni GN=GK218... 34 4.2
tr|B4L5E2|B4L5E2_DROMO GI21535 OS=Drosophila mojavensis GN=GI215... 34 4.2
tr|B4GS38|B4GS38_DROPE GL25317 OS=Drosophila persimilis GN=GL253... 34 4.2
tr|Q7LT36|Q7LT36_ASPSO AFLR regulatory protein (AFLR) OS=Aspergi... 34 4.2
tr|Q2GNK2|Q2GNK2_CHAGB Putative uncharacterized protein OS=Chaet... 34 4.2

>tr|Q5K7F1|Q5K7F1_CRYNE RNA polymerase II transcription factor,
putative OS=Cryptococcus neoformans GN=CNN00060 PE=3
SV=1
Length = 919

Score = 39.3 bits (90), Expect = 0.10
Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
Frame = +3

Query: 60 HAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ-*AQPHTHT 236
H H Q H H S+Q HP+ P SQ N AH+Q +QPH HT
Sbjct: 136 HRHPQAQQQHQHHAHQSQQQQHPSQPHPTSQ--------SNQQSHPHAHHQAYSQPHAHT 187

Query: 237 QNHKVHK*PMHP 272
H H MHP
Sbjct: 188 --HTDHMQSMHP 197


>tr|Q55HW7|Q55HW7_CRYNE Putative uncharacterized protein
OS=Cryptococcus neoformans GN=CNBN0050 PE=3 SV=1
Length = 919

Score = 39.3 bits (90), Expect = 0.10
Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
Frame = +3

Query: 60 HAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ-*AQPHTHT 236
H H Q H H S+Q HP+ P SQ N AH+Q +QPH HT
Sbjct: 136 HRHPQAQQQHQHHAHQSQQQQHPSQPHPTSQ--------SNQQSHPHAHHQAYSQPHAHT 187

Query: 237 QNHKVHK*PMHP 272
H H MHP
Sbjct: 188 --HTDHMQSMHP 197


>tr|B4LWW7|B4LWW7_DROVI GJ23490 OS=Drosophila virilis GN=GJ23490 PE=4
SV=1
Length = 1099

Score = 37.4 bits (85), Expect = 0.38
Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
Frame = +3

Query: 66 HKSVQSLHTHQHMASKQDPHPTNPQ-HGSQPCPLPLCPRN*YPKIRA--HYQ*AQPHTHT 236
H ++Q+ H H H +Q PHP P GS P + I A H Q Q H
Sbjct: 805 HPTLQASHAHPHAQQQQQPHPQPPSCAGSLQQPQQQQQQQQPHSIHAHPHTQQQQQHQQQ 864

Query: 237 QNHKVHK*PMHP 272
Q+H H+ HP
Sbjct: 865 QHHHQHQPQPHP 876


>tr|B4KJY5|B4KJY5_DROMO GI23919 OS=Drosophila mojavensis GN=GI23919
PE=4 SV=1
Length = 1179

Score = 37.0 bits (84), Expect = 0.50
Identities = 22/72 (30%), Positives = 28/72 (38%), Gaps = 1/72 (1%)
Frame = +3

Query: 60 HAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAH-YQ*AQPHTHT 236
H H VQ +H+H H PHP QH Q +P+ +H + PH H
Sbjct: 943 HHHLPVQHMHSHLHQHPHPHPHPHPHQHSHQ-----------HPQPHSHPHPHPHPHPHP 991

Query: 237 QNHKVHK*PMHP 272
Q H M P
Sbjct: 992 QQLGCHNLDMQP 1003


>tr|B3MA92|B3MA92_DROAN GF25137 OS=Drosophila ananassae GN=GF25137
PE=4 SV=1
Length = 825

Score = 37.0 bits (84), Expect = 0.50
Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
Frame = +3

Query: 66 HKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHTHTQNH 245
H Q H QHM Q PH + HG Q PLP + +P + + + H+H+ +H
Sbjct: 635 HLQHQQQH-QQHML--QHPHTHSHPHGQQQ-PLPHPHTHPHPHPHSPHPHSHSHSHSHSH 690

Query: 246 KVHK*PMHPLQDFAIL-YPKHYSP 314
H P P + A+ +P HY P
Sbjct: 691 PHHLQPGTPTRSPAMAPHPHHYPP 714


>tr|Q7Q6F2|Q7Q6F2_ANOGA AGAP005880-PA OS=Anopheles gambiae
GN=AGAP005880 PE=4 SV=4
Length = 680

Score = 36.6 bits (83), Expect = 0.65
Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 3/70 (4%)
Frame = -1

Query: 363 KRKEVLQVDRFMEEPKEVSNALDTGLQS---LEEDALATYVPCDFGCECEVELIDNEHVS 193
+R E +Q ++++EE LD G Q+ L YVP GC+ E++D E
Sbjct: 393 RRHETVQTEKYLEELFLHPPELDAGCQTDLFLHRAPSPPYVPAKTGCDAATEILDGELFD 452

Query: 192 LDTSSLDIRE 163
DT I E
Sbjct: 453 FDTEVQPIIE 462


>tr|B3NTG0|B3NTG0_DROER GG18108 OS=Drosophila erecta GN=GG18108 PE=4
SV=1
Length = 1373

Score = 36.6 bits (83), Expect = 0.65
Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 3/74 (4%)
Frame = +3

Query: 60 HAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRA---HYQ*AQPHT 230
H + H H H P P +P P P P P + +P + H+ PH
Sbjct: 590 HPQAAFPHHHPHPHHHPPPPPPPPHPHPHPHPPPPPTPPPHLHPHHQPPPHHHPLPHPHP 649

Query: 231 HTQNHKVHK*PMHP 272
H Q H P+HP
Sbjct: 650 HPQMHPQPHPPLHP 663


>tr|A9P7G7|A9P7G7_9SAUR Amelogenin (Fragment) OS=Aplopeltura boa
GN=AMEL PE=4 SV=1
Length = 110

Score = 35.8 bits (81), Expect = 1.1
Identities = 24/83 (28%), Positives = 36/83 (43%)
Frame = +3

Query: 57 SHAHKSVQSLHTHQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*AQPHTHT 236
+H H +Q++H H Q P P NP H QP P P N + ++ HY Q
Sbjct: 16 THFH-GIQAIHPALHQMQPQQP-PQNP-HWQQPVLNPFVPLNGHNRLIPHYPSVQHPLQP 72

Query: 237 QNHKVHK*PMHPLQDFAILYPKH 305
Q + P P+ ++P+H
Sbjct: 73 QAGEHPMQPQPPVNPNQSMHPQH 95


>tr|Q9VRN4|Q9VRN4_DROME Blimp-1 OS=Drosophila melanogaster
GN=Blimp-1 PE=2 SV=1
Length = 1203

Score = 35.4 bits (80), Expect = 1.4
Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
Frame = +3

Query: 87 HTHQHMASKQDPHPTNPQHGS--QPCPLPLCPRN*YPKIRAH-YQ*AQPHTHTQNHKVHK 257
H H H+ +Q +P Q G+ + P P + +P H +Q AQPH H H HK
Sbjct: 5 HNHNHLPQQQPQNPQEQQSGAIMKAANQPHHPAHSHPLNHPHPHQHAQPHPHPHPHPHHK 64


>tr|B6MWK1|B6MWK1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_124949 PE=4 SV=1
Length = 2659

Score = 35.4 bits (80), Expect = 1.4
Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 5/106 (4%)
Frame = +3

Query: 51 STSHAHKSVQSLH----THQHMASKQDPHPTNPQHGSQPCPLPLCPRN*YPKIRAHYQ*A 218
++SH H + H +H HM S PH +P H P P +P +++ +
Sbjct: 579 TSSHHHGPQANSHGSSASHSHMLSSAHPHIPSPTHPHVPSPA-------HPHVQSP---S 628

Query: 219 QPHTHTQNHKVHK*PMHPLQDFAILYPKH-YSPL*ALP*ICQPARP 353
PH + +H P HP + P H + P A P I PA P
Sbjct: 629 HPHVPSPSHPHVPSPSHP----HVPSPAHPHVPSPAHPHIPSPAHP 670