BP920879
Clone id YMU001_000142_H01
Library
Length 396
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000142_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACAACAGCAGGGTCGAGAATAGCAATAGTGTGGGAGGCGGCCGGGACGGGGCGTGGCCGC
CGATGATGTCCGATCGATCGGTCTTGACCATGAGCATGCAGCTATCTTTGGGAGTACTAC
AGGTTGGTCTAATCCCCCTTGTCCTCTTGCTTAGCATAGCCATATTGGTCAGTATAGGGA
TCGATCCCTTGAGCTCCCTCTTCTTGGATAATCTCACATCAAAGCATCAAAATGAGTAGT
GGCCGTCGCCGCTGCGGATGCCACCCTGACTTCAACAGCAAAGCAATATGTGAGTGTTCC
CCTTCAAGTCCTACTTCTCTTAGTGGCATTTATCCAATCCCTCTTGCTCATACCCAAAGG
TCATTTAATATCTCACCATCCTCTCTAGATGGTGAG
■■Homology search results ■■ -
sp_hit_id Q2VZ16
Definition sp|Q2VZ16|Y4355_MAGMM UPF0161 protein amb4355 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Align length 36
Score (bit) 30.0
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920879|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_H01.
(396 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2VZ16|Y4355_MAGMM UPF0161 protein amb4355 OS=Magnetospirillu... 30 3.7
sp|A1D9Y2|NTE1_NEOFI Lysophospholipase nte1 OS=Neosartorya fisch... 29 6.4
sp|Q4WA15|NTE1_ASPFU Lysophospholipase nte1 OS=Aspergillus fumig... 29 6.4
sp|P54934|BISC_RHOSH Biotin sulfoxide reductase OS=Rhodobacter s... 29 6.4

>sp|Q2VZ16|Y4355_MAGMM UPF0161 protein amb4355 OS=Magnetospirillum
magneticum (strain AMB-1 / ATCC 700264) GN=amb4355 PE=3
SV=1
Length = 89

Score = 30.0 bits (66), Expect = 3.7
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 280 KAICECSPSSPTSLSGIYPIPLAHTQRSFNISPSSL 387
K IC C P + G P+P AHT+R + PS L
Sbjct: 55 KRICRCHPWND---GGYDPVPPAHTERGGTMCPSRL 87


>sp|A1D9Y2|NTE1_NEOFI Lysophospholipase nte1 OS=Neosartorya fischeri
(strain ATCC 1020 / DSM 3700 / NRRL 181) GN=nte1 PE=3
SV=2
Length = 1523

Score = 29.3 bits (64), Expect = 6.4
Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%)
Frame = +1

Query: 217 HQSIKMSSGRRRCGCHPDFNSKAICECS-----PSSPTSLSGIYPIPLAH 351
H+S K SS +RR HPD ++A+ + + S+ L+ +YP AH
Sbjct: 369 HESRKHSSRKRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPRATAH 418


>sp|Q4WA15|NTE1_ASPFU Lysophospholipase nte1 OS=Aspergillus
fumigatus GN=nte1 PE=3 SV=1
Length = 1522

Score = 29.3 bits (64), Expect = 6.4
Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%)
Frame = +1

Query: 217 HQSIKMSSGRRRCGCHPDFNSKAICECS-----PSSPTSLSGIYPIPLAH 351
H+S K SS +RR HPD ++A+ + + S+ L+ +YP AH
Sbjct: 368 HESRKHSSRKRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPRATAH 417


>sp|P54934|BISC_RHOSH Biotin sulfoxide reductase OS=Rhodobacter
sphaeroides PE=3 SV=1
Length = 744

Score = 29.3 bits (64), Expect = 6.4
Identities = 10/27 (37%), Positives = 18/27 (66%)
Frame = +2

Query: 53 VAADDVRSIGLDHEHAAIFGSTTGWSN 133
+ A ++R + DH +AAIF + GW++
Sbjct: 66 LVAGEIRRVSADHGNAAIFAGSYGWTS 92


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920879|Adiantum capillus-veneris mRNA, clone:
YMU001_000142_H01.
(396 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******